CAZyme Information: FOIG_15627-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_15627-t36_1-p1
• CAZy Family: GT31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488	JH658320.1|CGC1	52668.10	5.5387

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658320.1:129238-131012(-)

Full Sequence      

MKLVLITGLFSAILATAQLTGPVGPLTALSQKTHECNILDYGAVNDNSTDIADAIEKTFK
TCVLPHAGSRLIVPDGQYLIKRSVILSNGTNWAFQLDGLITLAYGGNWTVDRKLVLQGFA
GVELLNATINGEGDGQFLQNGLTIINPVDFEFYSQNGKGAIQGQGYIYRNLANTFRPRLV
RIISPINTSVHDLILVDSPKFHIVFDFAENLEVYHLTIRGANLGSYDGVDVVGTNYWIHD
IEVTNRDECVSVKSPSNHALIENLVCNQAGSGISIGSLNVSASIANIHARNINIIQGNNI
AFIKTYPGGSGHVTNITFENFRSKASLYGLDINQYWQNTFEPDTGAVALSNLVFKNFSGS
VADGSKRPPLFLVANDLSFATNVTVEDFSIWTESGSSVVNKISNIFGHGDNSYGQANGIK
SLSSGQAPTAYTSTYTVTATPTGWAAPSFPTWAAASTGYGTDVPIPVYTPAALWKPEGDY
DKHYWGSF

Enzyme Prediction     

No EC number prediction in FOIG_15627-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	149	396	1e-47	0.7353846153846154

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	2.38e-20	159	405	61	315	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	8.58e-17	6	362	51	383	polygalacturonase ADPG
215426	PLN02793	8.82e-17	40	398	57	414	Probable polygalacturonase
215540	PLN03010	1.83e-15	37	412	48	396	polygalacturonase
227721	Pgu1	4.85e-15	37	320	84	392	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD50641.1|GH28	0.0	1	488	1	488
QGI79884.1|GH28	0.0	1	488	1	488
QGI93610.1|GH28	0.0	1	488	1	488
QGI62718.1|GH28	0.0	1	488	1	488
CCT66526.1|GH28	0.0	1	488	1	488

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	5.63e-99	18	466	1	404	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
1CZF_A	3.93e-08	217	365	173	322	Endo-Polygalacturonase Ii From Aspergillus Niger [Aspergillus niger],1CZF_B Endo-Polygalacturonase Ii From Aspergillus Niger [Aspergillus niger]
1BHE_A	4.13e-08	82	356	40	332	Chain A, POLYGALACTURONASE [Pectobacterium carotovorum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QYE5|RHGA_ASPNC	4.81e-100	13	476	14	431	Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgA PE=3 SV=1
sp|P87160|RHGA_ASPNG	1.35e-99	13	476	14	431	Rhamnogalacturonase A OS=Aspergillus niger OX=5061 GN=rhgA PE=1 SV=1
sp|Q00001|RHGA_ASPAC	1.78e-98	14	466	15	422	Rhamnogalacturonase A OS=Aspergillus aculeatus OX=5053 GN=rhgA PE=1 SV=1
sp|B8NKB9|RHGE_ASPFN	1.30e-97	18	476	22	437	Probable rhamnogalacturonase E OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rhgE PE=3 SV=2
sp|Q5ARE6|RHGA_EMENI	5.01e-97	13	476	13	430	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000249	0.999708	CS pos: 17-18. Pr: 0.9728

TMHMM  Annotations     

There is no transmembrane helices in FOIG_15627-t36_1-p1.