CAZyme Information: FOIG_15573-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_15573-t36_1-p1
• CAZy Family: GT3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
846	JH658319.1|CGC2	94304.64	5.0650

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658319.1:129528-132170(+)

Full Sequence      

MGSIDRDISSELSLEDAVSLLSGHDFWHTRPNEALGLGSLKFSDGPNGVRGEDWINGAPS
AAIPCGTALGASFDVELVSKLAGVLARECKRKGVHGLLAPTMNIHRYPLCGRNFESFSED
PLLTGLVAASFVNGLQAQGIATSPKHFLANEAENGRRWSDSVIEERALREIYIEPFRIVV
EQADPWCIMTAYNSVNGSFCSESLNLLSILRDEWRYNGAVISDWFGTYSTAEAFKAGLDL
EMPGPTKFREYDQVLKAIKRGGVKKHQITDSATRVIDLLRKTDRVGEPGFPLPLKAEEPD
YLDDIKSRMLIRQTAESSMVLLKNDRDILPLVDRDTRLAVFGHHATEPSLFGGGSASLKV
PYSSTPWDALKKTYKNSTLGAGVAVNRLVPLPNESGLDIENIALLWYNGDQPSTEKLFHA
QELKDTLYMLVEHAPHGLLDRSDFCTSMKFEFVAQKTGPYNLSLSGPGNAKCLLDDWVVL
DVERDLNVSTEDFLFERSKLEICRDEPLLLETGRRYKFEVLSWSSKHKSHKVNREFFIQG
CRLGLALASDDDRALARAERLAETVDTALVVVGTGTEWESEGFDRVSMQLPRRQDELILR
VAKACHGQTTVVVNAGSPIDTSAWIDAVDAVIYAWFPGMEFGNALARVISGEVSPCARLP
TTFWDTVEDYPAGHVESLMTSDKEIHYREGIYVGYRQQSLQTYNPRFAFGHGLSYTTFSC
SVKSLMYFTFDPRQETAQVALTVRNTGSLAASQTVLLFVEALEPATPRPNVELRAFAKTE
ILEPETSQDLEFCLKARDFSWWDVKDHFWRVDTGNYRIRVAGPRGAGDWKNIEDITVRFD
EGMTIA

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	243	2.9e-59	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	5.77e-62	35	366	58	382	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	3.26e-45	319	695	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
185053	PRK15098	3.34e-40	64	805	121	736	beta-glucosidase BglX.
395747	Glyco_hydro_3	8.63e-34	64	278	89	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.02e-29	71	767	122	718	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD50590.1|GH3	0.0	1	845	1	845
CCT66579.1|GH3	0.0	1	845	1	845
QGI93649.1|GH3	0.0	1	845	1	860
QGI62759.1|GH3	0.0	1	845	1	860
CEF86475.1|GH3	0.0	1	845	1	847

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	6.09e-150	6	821	7	822	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.34e-145	6	821	7	822	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.63e-104	6	821	6	654	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	8.28e-90	6	821	5	699	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.15e-88	6	821	5	699	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DPG0|BGLH_NEOFI	2.01e-149	8	821	10	806	Probable beta-glucosidase H OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglH PE=3 SV=1
sp|Q2U9M7|BGLH_ASPOR	1.47e-148	8	821	8	804	Probable beta-glucosidase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglH PE=3 SV=2
sp|A1DNN8|BGLJ_NEOFI	2.05e-148	1	822	1	842	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|Q4WLY1|BGLJ_ASPFU	2.11e-148	1	822	1	843	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|B0Y8M8|BGLJ_ASPFC	5.85e-148	1	822	1	843	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.971008	0.029010

TMHMM  Annotations     

There is no transmembrane helices in FOIG_15573-t36_1-p1.