CAZyme Information: FOIG_14832-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_14832-t36_1-p1
• CAZy Family: PL3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514		57176.58	5.3682

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658310.1:232864-234512(-)

Full Sequence      

MEGLKRLLLFTNSDFGQANVVLATAHELGIACEDVEIHIASFQDLRSGVDDASRFMQTTA
AQQKKKTPRPFVFHKIEGTSWGLATKRPETAIFETLELTPGVVNSAKGVAILPAVMIPWS
PREFLDMYKETERVFDEVNPDLTIVEPLFTQGLTFCHYRGARWMVLSPNTIKEFAVPVQP
KLAALWNSACSALPYPIPWSLIPWNIYFGFVAGYTLLTDTRLKKTTEILRDEIDPSISLM
TMMELGVLRPAPPNLPILVASSPDIDYPFSIIPPQLTSCGPIIRAAPPIREVDAGLAEWL
SQGSTVYVNLGTHHKSNPTEAHQMSKAFRKVLEHADTLHSAGKPLQILWKLGRVPDEEGN
APKRDTYTGEWALVTDELQAYIKSDRVRLTDWLVAEPKSVLGSQSIVCSVSHGGANSFYE
ALCSGIPQALLPAWTDCYDFANRVELLGIGLWANKEAKPRWQEDELAEALLEILFGPESA
GMRKRAEEGASRHPEWEGRQMAAQEILNYLTRLG

Enzyme Prediction     

No EC number prediction in FOIG_14832-t36_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	2.67e-27	84	509	49	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.16e-14	120	506	36	395	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
215127	PLN02210	9.18e-12	291	488	254	427	UDP-glucosyl transferase
178170	PLN02555	4.40e-09	265	486	230	439	limonoid glucosyltransferase
278624	UDPGT	1.93e-07	264	477	236	409	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60995.1|GT1	0.0	1	514	1	513
CCT74337.1|GT1	0.0	1	513	1	512
QGJ00663.1|GT1	0.0	1	513	1	512
QGI69774.1|GT1	0.0	1	513	1	512
CEI70655.1|GT1	1.48e-288	5	513	5	515

PDB Hits     

FOIG_14832-t36_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A411KZY6|BUAB_ASPBU	2.63e-66	1	511	1	489	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	2.91e-59	7	491	8	476	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|A0A0D1DZV5|EMT1_USTMA	1.36e-14	6	506	2	558	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|M9MH90|EMT1_PSEA3	1.64e-08	387	504	443	557	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1
sp|Q9SKC1|U74C1_ARATH	1.22e-07	400	487	341	429	UDP-glycosyltransferase 74C1 OS=Arabidopsis thaliana OX=3702 GN=UGT74C1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOIG_14832-t36_1-p1.