CAZyme Information: FOIG_14459-t36_3-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_14459-t36_3-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
665		74946.38	6.0975

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658308.1:182718-184764(-)

Full Sequence      

MNQKFANKIIEIYKPGDIVIIHDYFLMLLPSMLRQRVPNMYISFFLHSPFPSSEFLRCLP
RRKEVLEGVLGSNLIGFQSYSYSRHFLSCCTRILGFPSDTLGIDAYGTRVQVGVFPIGID
AAKVESHAWTDAVTAKYNALRELYRGKKIIVGRDRLDSVRGVAQKLQAFERFLEMYPEWR
EKVVLIQVTSPTSVEAEKEDLEDDTKVATRVNELVMRINGMYGSLGFSPVQHYPQYLSQN
EYFALLRAGDIGLITSVRDGMNTTSLEYIICQKEGNAPLILSEFSGTAGSLSDAIHINPW
DLSGVAEKINAALTMSEDKRQEMQSRLYRHVTEHNVQSWITKFIRKVYNVLGDSSSANST
PLLDRALLLTQYRSANKRLFMFDYDGTLTPIVREPSAAVPSERLIHTLDLLASDPKNAVW
IISGRDQEFLKQHLGNNRRLGFSAEHGSFMKHPGSDEWENLAEKFDMGWQAEVMEVFQKY
TDRVQGSFIERKRCALTWHYRLADPEQGIHMSRECHKELESTVGAKWDVEVMPGKANIEV
RPTFINKGEIAKRLITMYHTPGAESEDKSGHLEFALCMGDDFTDEDMFRSLNAASGPVLD
ANHVFTVTVGASTKVTLAKSHLLEPEDVIECVALLAGVQDVGERLGEVNLGALSAVEGHI
PNDER

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	1	347	1.2e-142	0.72

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	1	345	120	460	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
184712	PRK14501	0.0	2	636	120	724	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
395781	Glyco_transf_20	4.68e-167	1	349	124	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
223457	OtsA	1.30e-148	1	350	133	480	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
215556	PLN03064	2.70e-143	2	588	218	807	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD49547.1|GT20	0.0	1	665	219	883
CCT67493.1|GT20	0.0	1	665	219	883
QGI63541.1|GT20	0.0	1	665	219	883
QGI94423.1|GT20	0.0	1	665	219	883
QGI80816.1|GT20	0.0	1	665	219	883

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXF_A	2.27e-125	2	344	184	520	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5DXN_A	7.09e-119	360	635	3	269	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 2 [Aspergillus fumigatus Af293],5DXO_A Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293],5DXO_B Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293]
5DXL_A	1.24e-113	360	635	3	269	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 1 [Aspergillus fumigatus Af293]
5DXI_A	1.43e-97	360	638	5	300	Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314],5DXI_B Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314]
6JBI_A	8.39e-87	1	347	117	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31688|TPS2_YEAST	2.25e-203	2	664	183	871	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|Q9P4D3|TPS2_ZYGRO	5.83e-196	2	664	189	878	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|P78875|TPP1_SCHPO	2.37e-194	1	636	196	813	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|O14145|TPS2_SCHPO	2.98e-154	2	630	204	844	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps2 PE=3 SV=1
sp|Q54K57|TPSA_DICDI	1.04e-149	2	628	132	727	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOIG_14459-t36_3-p1.