CAZyme Information: FOIG_14144-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_14144-t36_1-p1
• CAZy Family: GT1
• CAZyme Description: lysozyme

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
193	JH658306.1|CGC1	21063.91	7.2180

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658306.1:275524-276333(-)

Full Sequence      

MKIHIFAAHFLAVASSAAFLITDEGRQFAKGTDVAITCQTEGTHIKGNVPWDKMTFGCYV
SDYYVATGSSRYVTSKCQNDPTGNPTVGYGHLCDAAQCSEVKYPIPLSIVNGKKLLADGM
KEFEICNPAMLNSKANLNRNQYGALISWAFNMGRGNADSSTLVGRLNNGEDPNTVISQEL
PQWVMPVARDFRV

Enzyme Prediction     

No EC number prediction in FOIG_14144-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	76	185	3.3e-18	0.7518248175182481

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381599	lyz_endolysin_autolysin	3.27e-22	79	184	17	114	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
226295	RrrD	2.86e-12	80	184	28	125	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
381620	lyz_P1	7.70e-10	80	184	23	118	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381619	endolysin_R21-like	1.02e-07	80	170	25	108	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
411609	sporang_Gsm	9.54e-07	26	90	15	83	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI87874.1|GH24	2.24e-102	1	184	1	224
QGJ01409.1|GH24	2.24e-102	1	184	1	224
QGI70519.1|GH24	2.24e-102	1	184	1	224
CCT75183.1|GH24	7.44e-101	1	184	1	224
QKD50435.1|GH24	1.10e-66	1	189	1	230

PDB Hits     

FOIG_14144-t36_1-p1 has no PDB hit.

Swiss-Prot Hits     

FOIG_14144-t36_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000357	0.999624	CS pos: 18-19. Pr: 0.5760

TMHMM  Annotations     

There is no transmembrane helices in FOIG_14144-t36_1-p1.