CAZyme Information: FOIG_13644-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_13644-t36_1-p1
• CAZy Family: GH76
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
864		93976.09	5.4334

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658302.1:322582-325222(-)

Full Sequence      

MDVEALIQQLTLEEKVQLTAGKSLTHYFLSNSLLTTFEGVGWWHTAAIERLSIPPIRLSD
GPNGVRGTHFFDSTPSSCLPCGTSLGATWNTDLIYRLGQLLSDEAHAKGAHVLLGPTVNI
QRGPLGGRGFESFSEDPILSGILAGHYVHGVQKNGVSATMKHFACNDMESARMAVDVQVT
ERALREVYLLPFMIAIEMASPRVVMTAYNKVNGTHAPDNHHLLQDILRDEWKWDGLVVSD
WFGTYSTTEAINAGQDLEMPGPTRWRGETLVHAVTSNKVKRSTLDDRVRNVLKLVKHSIE
NTSIPPNAPETQLQSEQNTRLLREAAAESVVLLKNDNGVLPLDPTKKVAVIGPNADISAY
CGGGSASLRAYHTVSPMEGIKGISKDVSFTKGLYGHRSLPQIGKLLKTVDGQRQGFTLRI
YNDPPPTSGPDTRKVLETRILDDSNIWFVDYEHPALEQIWYAEIEGVLSPEKSGEWDFGL
CVHGTGELFIDGELVVSNVTDQKPGSSFLGCGTVEKTGNKMLDGGKSYNVVVRWGCDKTS
DLKVSGVVDFGQGGMRLGGCPRLEPRQALEEAVGLAKSVDQVVLCVGTSGEWESEGQDRA
NMSLPPGSDDLISAVLQANPNTVVLIQSGTPVSMPWVDQASTIAQAWFGGNEAGNGIADV
LFGAVNPSGKLPITMPRRVADNPSALNFRSEGGRVLYSEDVHVGYRWYDTLDIEPLFPFG
HGLSYTTFELSDLHIEEHLVSESNKLAVSVNVSNTGSRCGAAVVQVYVKPPHPTPLTASA
LDTITRSSKELKGFAKINLDAGASGVAKIELDVLRATSYWSEREDYWCSDAGEYTVLVGT
SSRCEFLEKTFTVRNAATWRGLRP

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	46	260	3.8e-66	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	4.14e-91	50	843	101	755	beta-glucosidase BglX.
224389	BglX	2.29e-76	45	386	50	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	4.22e-55	330	725	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.47e-41	50	294	63	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	3.17e-41	5	812	55	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT63210.1|GH3	0.0	1	863	1	845
QGI90581.1|GH3	0.0	1	863	1	845
QGI59669.1|GH3	0.0	1	863	1	845
QKD46578.1|GH3	0.0	40	863	1	824
QGI76869.1|GH3	0.0	1	863	1	830

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.41e-251	2	862	5	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.61e-246	2	862	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	4.42e-142	1	860	3	675	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.07e-117	7	843	9	653	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.61e-106	3	853	4	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U8Y5|BGLI_ASPOR	0.0	1	862	4	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	0.0	2	862	5	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	0.0	1	862	4	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|B0Y3M6|BGLI_ASPFC	0.0	1	862	4	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1DNN8|BGLJ_NEOFI	0.0	3	862	14	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOIG_13644-t36_1-p1.