CAZyme Information: FOIG_13442-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_13442-t36_1-p1
• CAZy Family: GH71|CBM24
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
232		25108.64	9.2086

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=KK036129.1:180106-180856(+)

Full Sequence      

MVSFTSLLAAVSAVTGVMALPSAQPVDGMSVVERDPPTNVLDKRTQPTTGTSGGYYFSFW
TDTPNSVTYTNGNGGQFSMQWSGNGNHVGGKGWMPGTSRTIKYSGSYNPNGNSYLAVYGW
TRNPLIEYYIVENFGTYNPSSGGQKKGEVNVDGSVYDIYVSTRVNAPSIDGNKTFQQYWS
VRRNKRSSGSVNTGAHFQAWKNVGLNLGTHDYQILAVEGYYSSGSASMTVSQ

Enzyme Prediction     

EC	3.2.1.8:61

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	54	228	3.7e-75	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	1.96e-106	53	227	1	175	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60786.1|GH11	2.42e-170	1	232	1	232
KNB08954.1|GH11|3.2.1.8	2.42e-170	1	232	1	232
QGI69960.1|GH11	2.50e-163	1	232	1	232
QGI87331.1|GH11	2.50e-163	1	232	1	232
QGJ00849.1|GH11	2.50e-163	1	232	1	232

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JRM_A	2.40e-144	41	232	3	194	Crystal Structure of a Xylanase at 1.56 Angstroem resolution [Fusarium oxysporum],5JRN_A Crystal Structure of a Xylanase in Complex with a Monosaccharide at 2.84 Angstroem resolution [Fusarium oxysporum f. sp. vasinfectum 25433]
6Y0H_A	8.84e-117	41	231	2	193	High resolution structure of GH11 xylanase from Nectria haematococca [Fusarium vanettenii 77-13-4]
4XQD_A	4.51e-95	46	231	3	189	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4XQD_B Chain B, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],5ZF3_A Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30],5ZH0_A Crystal Structures of Endo-beta-1,4-xylanase II [Trichoderma reesei RUT C-30],5ZO0_A Neutron structure of xylanase at pD5.4 [Trichoderma reesei RUT C-30]
1ENX_A	4.66e-95	46	231	4	190	Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1ENX_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1RED_A Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1RED_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1REE_A Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1REE_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1REF_A Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1REF_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1XYO_A Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1XYO_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1XYP_A Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1XYP_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],2DFB_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],2DFC_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],3AKP_A Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKP_B Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKQ_A Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKR_A Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKS_A Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKT_A Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKT_B Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3LGR_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4HKW_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4S2D_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4S2F_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4S2G_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4S2H_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],7MGU_A Chain A, Endo-1,4-beta-xylanase [Trichoderma reesei]
2JIC_A	4.66e-95	46	231	4	190	High resolution structure of xylanase-II from one micron beam experiment [Trichoderma longibrachiatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1RII8|XYNB_GIBZE	6.86e-126	1	231	1	227	Endo-1,4-beta-xylanase B OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=XYLB PE=1 SV=1
sp|G2X4G0|424Y_VERDV	8.72e-114	1	231	1	223	Effector Vd424Y OS=Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) OX=498257 GN=VDAG_05042 PE=1 SV=1
sp|G0RUP7|XYN2_HYPJQ	1.59e-102	1	231	1	223	Endo-1,4-beta-xylanase 2 OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=xyn2 PE=1 SV=1
sp|P36217|XYN2_HYPJR	1.59e-102	1	231	1	223	Endo-1,4-beta-xylanase 2 OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=xyn2 PE=1 SV=2
sp|B5A7N4|XYN2_TRIHA	5.41e-98	1	231	1	221	Endo-1,4-beta-xylanase 2 OS=Trichoderma harzianum OX=5544 GN=Xyn2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000431	0.999549	CS pos: 19-20. Pr: 0.9477

TMHMM  Annotations     

There is no transmembrane helices in FOIG_13442-t36_1-p1.