CAZyme Information: FOIG_13424-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_13424-t36_1-p1
• CAZy Family: GH7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
837		91099.04	5.4027

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=KK036129.1:140244-142856(-)

Full Sequence      

MANTDIDAIIQSLTLEEKVSLLAGRNFSETVGYPEKGVPSIKTADGPNGIRSAATDLDIK
SACFPAACNLAATFDLDLAEKFGKALGAEARGKRVNCMLGPTVCMHRHPLGGRNFESYSE
DPFLTGKMSSKVIQGLQSLGISATIKHFVANEQETARTTVDEIIDERALREIYLRPFEIA
VKEANPWAIMTAYNHVNGVHCDEHKWLLQEVLRGEWGWKGLVMSDWGGTNSVAAALNAGL
DLEMPGPPRLRKEDAVKEALERGDLTESTINERAKSVVEWALKLKAREAEPHSVALGQDT
NTPELRSMIREAGARGIVLLKNQGDLLPLTREKVQKKKIALIGFAKDAMAHGGGSAAVNA
YRKITPWQGLHEALGDDVEFTYARGAHRERLLPAIHPDGLCGKVVGLDGKPGFSRQLFKE
GEAEPVSTVGQPTSAYSPLGSQESLWRRLEIVGDFTPAETGEHYIACSGLGPTRVYVDGE
IIYEQTANCTDPMGSLFLAAPEPEFRHKFEGGKTYRLRICSDPPTKIGLTILEGRSGVRV
GFSLESDHDADLVGEAADVAKAADYAIVFTGHDPQWETEGRDQDGFNLPRKGTQDALVST
VASVNPNTVVVNSTGVAIAMPWLEQVPAVVQAWFPGQECGYSIADVLTGAVNPEGRLPVS
FPKSVEDCPAHGNFPGEYVDGQLKVTYAEGVFVGYRHFDRLPREKVNFPFGHGLSYTTFT
YDLGNVYREGDDWYVSAQVSNTGKQAGGALLQIYAGPAEQSPDHPIKALVAFQKVRLEPS
ETKLVKLLVKQRDLAHFDTGLKKWVIDEGEYRFSLGVSSADIVGDTVVKVQKAVFDP

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	245	3.5e-69	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.01e-68	37	380	59	393	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.05e-62	64	836	120	763	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	2.25e-53	317	695	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.02e-42	37	279	65	315	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.88e-42	8	789	55	742	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60802.1|GH3	0.0	1	837	1	837
QGI87315.1|GH3	0.0	1	837	1	837
QGJ00832.1|GH3	0.0	1	837	1	837
CCT74517.1|GH3	0.0	1	837	1	837
QGI69943.1|GH3	0.0	1	837	1	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	8.39e-180	1	835	1	841	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	9.95e-175	5	835	5	841	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	6.07e-133	5	834	4	672	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	3.29e-113	6	822	4	705	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	4.85e-112	6	822	4	705	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	0.0	6	837	11	845	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P07337|BGLS_KLUMA	1.06e-176	1	835	1	841	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1
sp|P27034|BGLS_RHIRD	1.47e-175	6	822	2	802	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	5.46e-175	1	832	1	832	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	4.29e-174	1	811	1	812	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999430	0.000590

TMHMM  Annotations     

There is no transmembrane helices in FOIG_13424-t36_1-p1.