CAZyme Information: FOIG_13212-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_13212-t36_1-p1
• CAZy Family: GH64
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
229	JH658300.1|CGC1	24327.10	7.1040

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658300.1:284490-285357(-)

Full Sequence      

MLLILRYLILFVTFVTCQEYGQPVNASCVSGAHITVARGSLELRGPGIIGAVAQQVLQRI
PHSEMISLEYPAIYNPYQPSQMEGVAALSVVLAQYVTVCPKTKIILLGFSQGAHVIADVM
CGASSIGFLPTKPSPSAITNNIAAVVLMGDPSTTKGQPFHVGSSVGNGVNIPRQKPEGCQ
CVSDKTVSFCDAGDPFCEAGGHDLRTHMNYVTAYGHVAVDYAVGMFHRT

Enzyme Prediction     

No EC number prediction in FOIG_13212-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	32	224	1.2e-40	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.26e-31	28	224	1	171	Cutinase.
223477	YpfH	0.006	100	151	97	158	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT62943.1|CE5	8.64e-151	1	228	1	227
QGI90331.1|CE5	4.92e-143	1	223	1	222
QGI59422.1|CE5	4.92e-143	1	223	1	222
QGI76630.1|CE5	4.00e-142	1	223	1	222
UPK99293.1|CE5	5.73e-107	1	228	1	224

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BS9_A	6.53e-25	33	221	6	201	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	6.53e-25	33	221	6	201	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	2.53e-24	33	221	6	201	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1QOZ_A	3.76e-23	33	221	6	201	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59893|AXE2_TALPU	3.12e-24	21	221	22	228	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	1.13e-22	21	221	20	232	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	5.30e-21	21	221	18	224	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|P9WP42|CULP1_MYCTO	1.48e-15	21	211	27	197	Carboxylesterase Culp1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2037 PE=3 SV=1
sp|P9WP43|CULP1_MYCTU	1.48e-15	21	211	27	197	Carboxylesterase Culp1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000218	0.999759	CS pos: 17-18. Pr: 0.9800

TMHMM  Annotations     

There is no transmembrane helices in FOIG_13212-t36_1-p1.