CAZyme Information: FOIG_12885-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_12885-t36_1-p1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403		42298.23	4.5019

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658298.1:202550-203761(-)

Full Sequence      

MPSINSLLTMALAGSASAAFQGFNYGATFTDGRVKAQSDFENEFKTAAGLEGTSGAFTSA
RLYTMIQGGSINQPISAIPAAIKTKTSLLFGLWASGDGFANEIAALKNTVDQYCGQLDDL
VAGISVGNEDLYRISPTGIKANENPGTNPDVLVDYIKQTRAAIKGTCLESVPIGHVDTWT
AYANASNNAVIEACDWLGMDAYPYFEDTKNNPISEGANLFKAAWNEVKAVAKGKEIWVTE
TGWPVSGKTYGKAVPSTKNARTFYEDVGCPMFGDINVWWYTLQDSAPQTPNPSFGVIGTE
LTEKPLYDLSCDENSKKGTLVSRSNDASGNVEHRFVSPSFATGNYTNGTVPVVPGTPTSL
VPTPSSTSGNGGSAATPLPGSGAQQLNSMGAAAVAFLLAAALL

Enzyme Prediction     

No EC number prediction in FOIG_12885-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	104	310	9.6e-17	0.7652733118971061

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.39e-29	20	296	45	294	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	2.29e-05	176	311	157	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD52953.1|GH17	2.31e-295	1	403	1	403
CCT64267.1|GH17	2.18e-284	1	403	1	403
QPC78631.1|GH17	5.29e-243	1	403	1	409
CEI68891.1|GH17	1.64e-241	1	403	1	407
QPC61276.1|GH17	1.89e-238	1	403	1	408

PDB Hits     

FOIG_12885-t36_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WG16|EGLC_ASPFU	9.29e-133	8	315	9	314	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	1.06e-132	8	315	9	314	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|Q2UUZ1|EGLC_ASPOR	1.30e-131	4	322	3	321	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	2.43e-131	8	315	9	314	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|A1CD22|EGLC_ASPCL	3.52e-121	7	322	6	321	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.841812	0.158187

TMHMM  Annotations     

There is no transmembrane helices in FOIG_12885-t36_1-p1.