CAZyme Information: FOIG_12314-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_12314-t36_1-p1
• CAZy Family: GT8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
516	JH658295.1|CGC1	55935.57	8.2740

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658295.1:110711-112319(+)

Full Sequence      

MKLFHLGALSLVFQASHGSSSHHHRRDDKPSMPIAPGTIQNCASWYDNDGSLPCELIPYA
WNLSLEDLIRWNPSITAECGNFKEGFSYCIQEKEAPAPISSTTTKFTTAPPSSTTLVPSK
TTPTKPSTTAVGGNGVETPDPIQPGMVSNCNKFYLVEQGDNCNAVSSKHGITLAQFTTWN
PKLGTGCSGLWADVWVCVSVIGHTATPTQSTKPTNGIETPLPIQAGMTKSCTKFHLIKST
TTCNSIQDYYKLPLKDFYSWNPAVGTNCQSLLVDYWVCVSVVGWTAPTPTTPSNGIATPT
PIQTGMTKNCNKFHTIKSTTTCASIQDYYKISFADFYAWNPSIGSKCTSLLVGYNVCVGV
IGQTPSPTSTGNGITTPTPIQAGMTKSCNKFHPVKSTTTCASIQDYYKISFADFYAWNPA
IGSKCTALWVDYNVCVGVVGQKPTPTQPSNDVTTPSPIQSGITKNCKKFHQVKSTTTCAS
IQNYYKITMANLFKWNPAIGSTCKSLWVDYWVCVQA

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
180536	PRK06347	1.24e-08	60	418	235	576	1,4-beta-N-acetylmuramoylhydrolase.
212030	LysM	2.39e-06	152	196	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
180536	PRK06347	6.26e-05	246	496	344	576	1,4-beta-N-acetylmuramoylhydrolase.
212030	LysM	7.51e-05	468	512	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	1.11e-04	312	356	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD52295.1|CBM50	6.48e-287	1	516	1	409
CZS82988.1|CBM50	1.64e-199	22	516	24	523
UPK92405.1|CBM50	1.64e-170	25	514	26	505
CZS72050.1|CBM50	9.57e-170	3	516	4	518
CEF84338.1|CBM50	2.72e-169	3	516	4	518

PDB Hits     

FOIG_12314-t36_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	7.65e-113	6	439	11	458	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4B4P8|LYSM2_ARTBC	1.63e-17	315	447	34	190	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AZ68|LYSM3_ARTBC	9.36e-12	139	281	256	408	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1
sp|D4AVW3|LYSM5_ARTBC	1.72e-10	30	200	357	536	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|D4B5F9|PGDA_ARTBC	1.79e-10	459	514	380	435	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.085149	0.914837	CS pos: 26-27. Pr: 0.1799

TMHMM  Annotations     

There is no transmembrane helices in FOIG_12314-t36_1-p1.