CAZyme Information: FOIG_12156-t36_3-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_12156-t36_3-p1
• CAZy Family: GH43|CBM91
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
448		50501.15	9.9067

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=KK036128.1:161108-162577(-)

Full Sequence      

MLLLRWLWIGNGKDGEIPPIAVFWTLRVLMFVISFVLEDWALHELIPSPKHRRVAVLLVA
SSYVTWTYQTHTFSNSVETLVVAWSLVLIQRVADPRQRSCVLSATVLGIVGVFGVFNRIT
FPAFLVVPGLRLLPVFWKRPTSLVYLTLAAALTTVIAIGLDTAFYLPGPITWTDLIHKPV
ITPLNNFKYNSATENLAQHGLHPWYQHLVGNLPLLLGPAAALLIIRPKLSIRLWSAVSGL
VVLSAFQHQEARFLLPTVPLFLSSIRMPRNQTILYGFTAVWIGFNLVLGSLMGIYHQGGV
VPGQVFLSQQPDATQAIWWKTYTPPIWLLNGKNEFLTTRDVMGLKGEVLLEQLYGLATCD
TPADRRNQEYLKEKNGTYLIAPASATWLDPYLSNKGLEGLRFREVWRYRKHLNLDDLDFG
DDGVWDTLARVIGRRGLVAWRVTKSCPN

Enzyme Prediction     

EC	2.4.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	3	328	7.4e-59	0.8200514138817481

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	1.29e-32	17	327	74	410	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD51275.1|GT22	0.0	1	448	70	517
QGI93033.1|GT22	0.0	1	448	70	517
QGI79306.1|GT22	0.0	1	448	70	517
QGI62138.1|GT22	0.0	1	448	70	517
CCT65953.1|GT22	0.0	1	448	70	516

PDB Hits     

FOIG_12156-t36_3-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I785|SMP3_GIBZE	0.0	1	448	70	517	GPI mannosyltransferase 4 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=SMP3 PE=3 SV=2
sp|Q2UTP0|SMP3_ASPOR	1.88e-136	3	448	72	543	GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=smp3 PE=3 SV=1
sp|Q4WTT7|SMP3_ASPFU	1.37e-134	1	445	70	544	GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=smp3 PE=3 SV=2
sp|Q5BAX7|SMP3_EMENI	5.16e-123	3	440	72	534	GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=smp3 PE=3 SV=2
sp|Q6CDD0|SMP3_YARLI	2.07e-71	3	418	75	495	GPI mannosyltransferase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=SMP3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000004

TMHMM  Annotations     

Start	End
20	42
54	73
108	130
143	165
203	225
273	295