CAZyme Information: FOIG_11910-t36_3-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_11910-t36_3-p1
• CAZy Family: GH43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
842		91520.72	7.8044

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658294.1:8843-11416(-)

Full Sequence      

MDLSRIKSHGLGHVAIDDSDTDNGPSGNVIDDGRVKVQFHDTPQALAQWCEHLKESFAGD
GADSEHLLPPKPSKPRRTSTVAFLPGVEKPAEGPRLNIAIHIVGSRGDVQPFIPIAQLLM
KPPYGHRVRICTHASFKEFVEAQGVEFFNIGGDPEALMAYMVKNPGLLPNKDSLKEGDVG
KRRKEMMEIISGTWRSCIEAGDGMGDPVKAANVENVDDLFLADVIIANPPSMGHIHCAQK
LNIPLHMVFTMPWSPTKAFPHPLAAMSYGDADAKVANYLSFMMMELLTWQGLGDLINKFR
RQTLHLDPISPMWGFQLLSRLRIPYSYLWSQTLIPKPSDWDEHLNITGFSFLPLASSYTP
PKDLLDFLEAGPPPIYIGFGSIVVKDPQALTNMILKAVELAGVRAIVSKGWGGVGVGEVP
DNVYLIGNCPHDWLFQRVSVVVHHGGAGTTAAGIAAGRPTVIVPFFGDQPFWGQMMARAG
AGPVSVPYKELTAEILADSIKFALKPEVQEVAKDMAIQIGEEDGAGGTAQDIQDRLDIDS
LRCDISPDRLASWLDRKTGAHLSGFAVGCLIDAGLLQSQNLKLLRHRHWYVDEGAEYPLV
GAVAAVSGFASAIGTATSDYAERLRNSPGRGKTRRSNVDDTQEGVLTDPEEVKTGEARLR
KGPRGANQKDMEILARKMATKTLNGAEPVFLTPKLRRPVTGLHQKHKKAWRAHEGGRNGR
VFYVTRVTGKYVGDLAAASARAPVAFFYNVANGFHNAPSNFWNVEVRRRDEITGLGSGLK
VAGKEFVLGFYDAFSGIVTKPYEDTKARGIKGLGRGLLRGGFGICGNLGAGKSLSFPQAP
ET

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	218	533	1.3e-56	0.7486910994764397

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	2.85e-65	96	525	1	394	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.47e-32	98	534	4	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.46e-17	98	260	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	6.03e-04	96	532	1	386	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD55584.1|GT1	0.0	1	830	1	830
CCT69700.1|GT1	0.0	1	834	1	834
QGI65525.1|GT1	0.0	1	830	1	830
QGI82773.1|GT1	0.0	1	830	1	830
QPC70230.1|GT1	0.0	1	832	1	828

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	2.18e-76	103	524	27	427	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	3.69e-76	103	524	47	447	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	6.60e-29	96	530	1	392	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	2.47e-28	96	516	1	362	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	1.71e-22	96	529	1	392	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	4.76e-129	94	530	191	604	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	5.34e-128	94	524	154	562	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|P0CN90|ATG26_CRYNJ	3.54e-77	78	613	1021	1545	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ATG26 PE=3 SV=1
sp|P0CN91|ATG26_CRYNB	3.54e-77	78	613	1021	1545	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ATG26 PE=3 SV=1
sp|Q9Y751|ATG26_KOMPG	1.62e-76	95	555	760	1210	Sterol 3-beta-glucosyltransferase OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOIG_11910-t36_3-p1.