CAZyme Information: FOIG_11472-t36_2-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_11472-t36_2-p1
• CAZy Family: GH39
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338		37795.09	5.7500

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658292.1:83236-84389(+)

Full Sequence      

MDGHNMISMGISGDGKIHLSFDHHDVPINYRISKNGIAKDVPSKWTSDLFGPVVHELVGS
QGPYSPLTYPRFEPLSNGDLLLEFRIGQSGSGDSYIHRYSASTGKWQAYGMYIQGDDNNA
YINGIDYLDGKLYTSWTVRETPNADTNHGVYFAYSNDDGKTWFNTNGTKLSKPISTSDDS
TLIWDVPQNSRMVNQEGQLIDIKGRFHILMRDLLSGEHLYQHYLRKPDGTWTKNAINPSG
LNGPDLYDPRGKLAGDASGEYLFGLLPDPVKQSTGIYVATASKDFKDWKSLAEIPNTSTE
PLFDKTRLHESGVLSVFVRQAGGFPDRKLQVWDFELDL

Enzyme Prediction     

EC	4.2.2.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL42	2	237	5.5e-77	0.7668918918918919

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406346	BNR_4	1.12e-62	2	233	38	268	BNR repeat-containing family member. BNR_4 is a family which carries the unique sequence motif SxDxGxTW which is so characteristic of the repeats of the BNR family, pfam02012. It is unclear whether or not this unit is repeated throughout the sequences of this family, but if it is then the family is likely to be bacterial neuraminidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCT36655.1|PL42|4.2.2.-	2.36e-252	1	338	82	419
QGI94760.1|PL42	1.37e-251	1	338	101	438
QGI63878.1|PL42	1.37e-251	1	338	101	438
QGI81148.1|PL42	1.37e-251	1	338	101	438
CCT67810.1|PL42	3.44e-251	1	338	88	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7ESK_A	1.99e-253	1	338	84	421	Chain A, L-Rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum],7ESM_A Chain A, L-rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
7ESL_A	3.29e-252	1	338	84	421	Chain A, L-rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
7ESN_A	5.03e-252	1	338	86	423	Chain A, L-Rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
5MUM_A	8.94e-33	2	208	93	288	Glycoside Hydrolase BACINT_00347 [Bacteroides intestinalis DSM 17393]
5MVH_A	1.62e-31	2	208	88	283	Glycoside Hydrolase BACCELL_00856 [Bacteroides cellulosilyticus DSM 14838]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A109PTH9|UL24S_ALTSL	4.09e-12	2	179	150	371	Ulvan lyase, short isoform OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_107 PE=1 SV=1
sp|A0A2Z6UD27|UL24L_GLASK	4.13e-11	2	206	136	377	Ulvan lyase, long isoform OS=Glaciecola sp. (strain KUL10) OX=2161813 GN=ullA PE=1 SV=1
sp|A0A0X9SHN5|UL24S_PSEXP	1.78e-10	2	179	150	371	Ulvan lyase, short isoform OS=Pseudoalteromonas sp. (strain PLSV) OX=1547444 GN=PLSV_3875 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOIG_11472-t36_2-p1.