CAZyme Information: FOIG_11443-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_11443-t36_1-p1
• CAZy Family: GH38
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
550		56709.81	4.1813

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658292.1:25276-26928(-)

Full Sequence      

MRLQSIAAILAAAATASAQSVSGKAYGFAAGVTGGEGEAVTPSSAEELATLLADDTPRVI
YLDKEFDFTGDVKTGAGCDRKSCSASNGGQLYLGDLSCGGDDNVAVSSITYDAAGPEPLP
VGSNKSIIGNGKAVLKGKGLSIKKGSKNVIVQGIEFTDINPGVVWGGDALELKGLNDGVW
IDHCKFSKVGRMFIVSHYDGSRLTISNSEFDGVTDTSASCNGNHYWTMMFYGEGDQVTLD
RNHFHDVAGRAPKLGEPGTNGYFHATNNYFQNMKGHAFDAYQGANAIIEGNVFDGVDTPI
TKEAASVSTLFVADESDASACQSALGRACVPNSATSSGDLPSLKGQSGLDAVAKNKDNII
TPVSASEVTALVLGSVGPANVGSGSNSGSGSDSAPSQSPESGNDATQTTPATPEATPETT
PETAPETTPEAVNEQEALPDRPEETEAEPVANAEVKPVASDDCEEETDATPSKTEEKPVA
TGDCDEEETSEAAADSSSSAGSSTAQMYGQCGGKNWTGATTCPSGSSCKKMNDYYSQCIG
SNSRVRRYVQ

Enzyme Prediction     

No EC number prediction in FOIG_11443-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	109	294	6.7e-76	0.983957219251337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.97e-43	108	297	3	190	Amb_all domain.
226384	PelB	2.99e-17	27	360	36	336	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	3.32e-16	118	293	29	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
395595	CBM_1	7.30e-14	507	535	1	29	Fungal cellulose binding domain.
197593	fCBD	2.98e-13	508	539	3	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61651.1|CBM1|PL1_4	0.0	1	550	1	548
CCT67826.1|CBM1|PL1_4	7.30e-305	1	550	1	609
QGI94784.1|CBM1|PL1_4	1.71e-303	1	550	1	609
QGI63902.1|CBM1|PL1_4	1.71e-303	1	550	1	609
CEI70546.1|CBM1|PL1_4	1.26e-246	1	549	1	600

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	1.16e-66	21	340	3	322	Pectin Lyase B [Aspergillus niger]
1IDK_A	1.05e-62	21	381	3	359	Pectin Lyase A [Aspergillus niger]
1IDJ_A	4.04e-62	21	381	3	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
6MVI_A	5.74e-09	504	538	258	292	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
5X39_A	4.70e-08	504	539	1	36	Chain A, Exoglucanase 1 [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	1.48e-96	14	384	16	383	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q0CFF7|PELF1_ASPTN	1.16e-88	1	377	1	384	Probable pectin lyase F-1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-1 PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	9.11e-86	7	385	10	387	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	9.11e-86	7	385	10	387	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	1.28e-85	14	386	16	387	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000274	0.999666	CS pos: 18-19. Pr: 0.9759

TMHMM  Annotations     

There is no transmembrane helices in FOIG_11443-t36_1-p1.