CAZyme Information: FOIG_11418-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_11418-t36_1-p1
• CAZy Family: GH37
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
580		64336.28	6.1423

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658291.1:647821-649563(-)

Full Sequence      

MAVNNGAYFDFIVVGGGTAGNIVAARLAENPNARILVIEAGIGTSKDNEEIRTPGLAMDI
RGSKYDWAYKTTMIKRDDYERIEKPNTRGKALGGSSSLNYFSWVPGSKGTFDMWEEYGGK
EWTWEPLVPYLRKSVTYHDDAGLYAPELKKIGAGGPIPIAHAELMPEMKPFRELLTKAWK
STGEPISENIFDGTMRGLVHSVNTIYKGRRSGSFLAVADKPNITIFPEVHSKRLIIDQAD
RIAKGVTVITASGEELDLYATREVIVSQGVFETPKLLMLSGIGPKTELAKHNIPLLVDSP
HVGQHLLDHPGVPFVLKIKDSYSMDNHVLRKGALQDKVMSAYANGHAGPMGSPFLEMIGF
PRIDSYLEKSPEYRAAKAANDGLDPFCPYGQPHFELDFIPLFGSAFQWHFPHPNKGSYMT
VMVDLVRPVSEGGEVTLNSSDPLQQANINLNYFNNDLDIIAMREGIRFSYDVLKNGEGFK
DIVEDEYPWDMPLHDDEAMKRTVLDRSQTSFHPCGTARLAKSIEEGVVNPSLQVHGIKNL
RVIDASVIPVIPDCRIQNSVYMVAEKGADAIKRDHADLYH

Enzyme Prediction     

No EC number prediction in FOIG_11418-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	574	1.6e-147	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	6.13e-83	9	576	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.08e-78	9	572	6	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.73e-38	428	566	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	6.68e-21	9	563	56	568	Protein HOTHEAD
366272	GMC_oxred_N	5.92e-18	88	310	23	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD59313.1|AA3_2	0.0	1	580	1	580
QGI68848.1|AA3_2	0.0	1	579	1	579
QGI99737.1|AA3_2	0.0	1	579	1	579
CCT73322.1|AA3_2	0.0	1	579	1	579
QGI86218.1|AA3_2	0.0	1	579	1	565

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	1.95e-317	5	579	3	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	5.58e-317	5	579	3	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	1.59e-316	5	579	3	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	3.47e-67	9	574	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.34e-66	7	574	1	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0R4L2|PDH3_LEUMG	6.48e-55	9	576	41	600	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q988C9|4PADH_RHILO	8.47e-55	9	571	7	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|A9AMZ9|BETA_BURM1	1.30e-54	9	572	6	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) OX=395019 GN=betA PE=3 SV=1
sp|B1Z034|BETA_BURA4	1.80e-54	9	572	6	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) OX=398577 GN=betA PE=3 SV=1
sp|Q0B711|BETA_BURCM	6.62e-54	9	572	6	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) OX=339670 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000013

TMHMM  Annotations     

There is no transmembrane helices in FOIG_11418-t36_1-p1.