CAZyme Information: FOIG_11111-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_11111-t36_1-p1
• CAZy Family: GH36
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
824	JH658290.1|CGC5	92549.16	8.8600

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658290.1:560683-563259(-)

Full Sequence      

MGMAPLNLVDPVVGSATAAVVFTTVSQYVPSRRLELCSEMVCWAVLPFLFRYTALPNARA
SSPLLSNPQKQRHSSLSQWLVAFSIVAAAFYRAESNTIGFYPLLTPLLLTVQTYFQPGSI
SSDPVPTSPLISTIKGTTLVAVLSAFSLSNGDLFGSLISIILVASLFIVYSIFIPGFTVK
VLSLSSVDIETNVKAIAGRTMVLLLIAVAFQTLVLGPPNSNIILVLFTGLVKALSWFFTI
QAARQTSWCIATTIGTFAIAGTRNPFSQTSQLQALSHVTVSILTLYQTSQFLPKQSKGKV
LLWSCLSASIIPYLYNEYIIHDATSSASAAFTSQSHPIELLAQEARSVFESRLKSQSRTY
LAAVKQYKQRYGLDPPPGFEAWFEYALKHNSPIIDEFDTIHSAISPFLKLSGNEVSEMIG
KVYKTPQSEVWLCQLSGKTAKTKCRHPSRSYDRHYSYIFDKLLWNLPGVLPDVKFLINHF
DEPRVVIRPQGGDVDKAIRLNDMSMHPTWDSVTKSCPSHKTYRDDQSGLETFGLPFVRDH
LSESDLCKHPEYKDIHGAFISPKTFRLIEGSAPVLSTGAFSTMGDILFPSPAYVEEEFQY
DKTHDVLWSEKKNNLYWTGSTTGGYALDDQWRNHQRQRFVALAQNLGHQEHTYLREKDGL
ISSVKSWFLNGRLYDVSFTRIFQCDRKFCRNQSTFFNVKSWADKDAAFHSKLAFDLDGNG
ISGRYYKLLSSNTLPLKQALLREWHDERLVPWVHYIPVSQSLEELPELVNYLTLNKAGQK
VAEKVARQGSEWMGKAVRDVDMTIYTWRLLLELARLQDPTRKGT

Enzyme Prediction     

No EC number prediction in FOIG_11111-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	561	817	1.4e-63	0.936

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.36e-08	608	817	80	253	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	4.66e-08	708	821	214	329	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD46606.1|GT90	0.0	1	824	1	823
CCT63185.1|GT90	0.0	1	823	1	822
QGI90556.1|GT90	0.0	1	823	1	811
QGI59644.1|GT90	0.0	1	823	1	811
QGI76844.1|GT90	0.0	1	823	1	811

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	2.43e-06	711	815	238	340	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	4.40e-37	320	821	139	660	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	1.12e-06	519	815	94	368	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999433	0.000569

TMHMM  Annotations     

Start	End
74	91
98	115
130	148
153	175
195	217
222	240