CAZyme Information: FOIG_10376-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_10376-t36_1-p1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
289	KK036127.1|CGC3	32194.94	7.4649

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=KK036127.1:213363-214281(+)

Full Sequence      

MRLTSFFQSAALVVASLSELSQAHYFTPRGFTTPKRKELWQPEVGTSWQIILSEVVKVPK
AGVSSMTPDVPIWDMDLFENSKSTITAMKKGGKKVICYFSAGSWENWRKDKDSFPKKDLG
KVMDGWPDERWVNISSVAVRAIMAQRIKLAAEKGCDAIDPDNMDGYQNDNGLGLTEGDTI
SYVKFLSTEAAKYNMVMGMKNGGDVTEEVLPYVAFCINESCIQYSECDLYQPYIDAGKPV
FNIEYPKGAPKVKAKDQKKICSTSGAAEGSDGFSKVIKKMNLDKWVLYC

Enzyme Prediction     

No EC number prediction in FOIG_10376-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	48	245	8.6e-73	0.9947368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397552	Glyco_hydro_114	1.68e-112	47	283	1	220	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
226386	COG3868	3.82e-31	27	245	48	266	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
225219	COG2342	1.40e-04	81	245	62	251	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61554.1|GH114	2.11e-213	1	289	1	289
CZS85814.1|GH114	7.04e-158	1	289	1	283
CEF86455.1|GH114	7.04e-158	1	289	1	283
QPC80209.1|GH114	9.99e-158	1	289	1	283
CEI70516.1|GH114	6.03e-156	1	289	1	280

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OJ1_A	2.04e-87	28	289	25	277	Crystal Structure of Aspergillus fumigatus Ega3 [Aspergillus fumigatus Af293]
6OJB_A	3.53e-87	28	289	42	294	Crystal Structure of Aspergillus fumigatus Ega3 complex with galactosamine [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

FOIG_10376-t36_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000277	0.999708	CS pos: 23-24. Pr: 0.9763

TMHMM  Annotations     

There is no transmembrane helices in FOIG_10376-t36_1-p1.