CAZyme Information: FOIG_10371-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_10371-t36_1-p1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
568	KK036127.1|CGC1	62412.38	4.8434

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=KK036127.1:200165-202068(+)

Full Sequence      

MDRASIRVIKLSSGCFSACIDYSPLVINMASLVFAALLASASGKTVKSPTPPMGWNSYNH
YNCRPSEDIIKINAKGLVDLGFKDLGYSIVTVDCGWPSRDRDSKGRLQWNETLFPSGPKA
LGEYIHDLGLEFGLYSGAGYLQCGSTDIPASLDYEEIDAKSFAEWGGDTLKYDNCYATSK
TNMVDADSAEAKSPNRFIKMAAAINETERDIKYFLCQWGIGEDVPQWAAPLGNSWRMSND
IFNAWRAIWRITNQVVAHAKYNGPGAFADMDMLIIGLGALSHDEERFHFGFWSMMKSPLI
IGGVMDAKQIPAESLEIMSNKEVIAINQDPLAEAAKLVIRYTEEEWDIWAGNLSSNRKVL
GVLNWKNETQTVKVDLSLIGVDKAAARDVWAHEDLSISGIQEFKLAPHELRQLVLSDISP
ASPPKAAGYYSAQDATLSGSASLVNCKDTECLPTHKKVGSIGKDAKVAFKSVSAPKDGSV
YLGIDYINHEYHHTIGDWETNSRNMSISVNGEDAKRWAFPNAGGDWFESDRLTILVDGFK
KGDSNEVTFTASASGNWAPDLVGFEVLE

Enzyme Prediction     

EC	3.2.1.22:1	3.2.1.88:1	3.2.1.22:1	3.2.1.88:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	149	395	3.6e-68	0.982532751091703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269893	GH27	5.47e-118	51	329	1	271	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
178295	PLN02692	6.27e-93	50	395	55	386	alpha-galactosidase
177874	PLN02229	1.25e-92	50	419	62	421	alpha-galactosidase
166449	PLN02808	7.36e-92	50	416	31	384	alpha-galactosidase
374582	Melibiase_2	4.76e-69	50	329	1	284	Alpha galactosidase A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61559.1|CBM35|GH27	0.0	1	568	1	568
BAH10648.1|CBM35|GH27|3.2.1.22|3.2.1.88	0.0	29	568	1	540
CEI70486.1|CBM35|GH27	0.0	29	567	1	542
QPC62824.1|CBM35|GH27	0.0	24	567	20	566
QPC80193.1|CBM35|GH27	0.0	24	567	20	566

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UAS_A	6.75e-85	50	416	8	360	Chain A, alpha-galactosidase [Oryza sativa]
6F4C_B	3.67e-72	50	416	8	361	Nicotiana benthamiana alpha-galactosidase [Nicotiana benthamiana]
3A5V_A	6.28e-68	50	422	8	397	Crystal structure of alpha-galactosidase I from Mortierella vinacea [Umbelopsis vinacea]
4OGZ_A	3.01e-58	50	364	99	419	Crystal structure of a putative alpha-galactosidase/melibiase (BF4189) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution [Bacteroides fragilis NCTC 9343],4OGZ_B Crystal structure of a putative alpha-galactosidase/melibiase (BF4189) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution [Bacteroides fragilis NCTC 9343]
1SZN_A	1.66e-55	46	409	7	404	Chain A, alpha-galactosidase [Trichoderma reesei],1T0O_A Chain A, alpha-galactosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AX28|AGALD_EMENI	6.88e-127	50	568	32	659	Alpha-galactosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglD PE=1 SV=2
sp|A4DA70|AGALD_ASPFU	5.39e-123	50	568	30	648	Probable alpha-galactosidase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=aglD PE=3 SV=2
sp|B0YEK2|AGALD_ASPFC	5.39e-123	50	568	30	648	Probable alpha-galactosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=aglD PE=3 SV=2
sp|A1D9S3|AGALD_NEOFI	6.60e-121	50	568	30	648	Probable alpha-galactosidase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=aglD PE=3 SV=1
sp|A2R2S6|AGALD_ASPNC	1.64e-114	50	568	31	660	Probable alpha-galactosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=aglD PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.459484	0.540515	CS pos: 43-44. Pr: 0.4562

TMHMM  Annotations     

There is no transmembrane helices in FOIG_10371-t36_1-p1.