CAZyme Information: FOIG_10359-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_10359-t36_1-p1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322	KK036127.1|CGC12	33674.77	7.8447

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=KK036127.1:173952-175129(-)

Full Sequence      

MRLLNILFLSGLATAAPGANLQARVAANDPCNIGYCTQNGGTTGGGSAAQVTVKTLAELT
AAAAADGPSVILVQGSISGAAKVQVTSNKSIIGKTGSSLTGIGLTINGQKNVIVRNMKIS
KVEADYGDAITIQKSTNVWVDHCDLSAVRGDDKDFYDGLVDLSHAADWVTISYTYFHDHS
KGSLVGHSDKNAAEDVGTLRVTYANNHFNNVRSRGPLLRFGTAHIFNQYYDTMDTGLNSR
MGAQALIQSSVFTNVGKKAIFSESSSEVGYVVAEDVVLGGESQNTAPKGTLSSSKIPYQF
TLLGSGKVASTVPGQAGQKLSF

Enzyme Prediction     

EC	4.2.2.2:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	73	252	6e-86	0.988950276243094

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.92e-66	73	256	2	190	Amb_all domain.
226384	PelB	2.24e-49	70	317	78	340	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	5.33e-41	82	252	29	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61571.1|PL1_7	4.48e-227	1	322	1	322
QPC80187.1|PL1_7	2.05e-207	1	322	1	322
CAW62380.1|PL1_7	2.91e-207	1	322	1	322
CAX07511.1|PL1_7	2.91e-207	1	322	1	322
CAW97007.1|PL1_7	2.91e-207	1	322	1	322

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	4.47e-38	34	256	6	250	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1PCL_A	1.29e-32	29	230	5	246	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
3ZSC_A	5.14e-30	41	256	20	230	Catalytic function and substrate recognition of the pectate lyase from Thermotoga maritima [Thermotoga maritima]
2QY1_A	1.44e-24	33	270	3	263	Chain A, Pectate lyase II [Xanthomonas campestris pv. campestris],2QY1_B Chain B, Pectate lyase II [Xanthomonas campestris pv. campestris]
2QXZ_A	3.78e-24	82	270	67	263	Chain A, pectate lyase II [Xanthomonas campestris pv. campestris],2QXZ_B Chain B, pectate lyase II [Xanthomonas campestris pv. campestris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00645|PLYB_EMENI	4.33e-121	1	320	1	326	Pectate lyase plyB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyB PE=1 SV=1
sp|Q0CBV0|PLYB_ASPTN	7.97e-114	1	320	1	325	Probable pectate lyase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyB PE=3 SV=1
sp|B8NBC2|PLYB_ASPFN	9.48e-113	1	320	1	326	Probable pectate lyase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyB PE=3 SV=1
sp|Q2TZY0|PLYB_ASPOR	9.48e-113	1	320	1	326	Probable pectate lyase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyB PE=3 SV=1
sp|O59939|PLYB_COLGL	5.53e-103	24	322	38	331	Pectate lyase B OS=Colletotrichum gloeosporioides OX=474922 GN=PLB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000210	0.999788	CS pos: 24-25. Pr: 0.9295

TMHMM  Annotations     

There is no transmembrane helices in FOIG_10359-t36_1-p1.