CAZyme Information: FOIG_09741-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_09741-t36_1-p1
• CAZy Family: GH27
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
611		68459.37	7.4252

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658287.1:451666-454151(+)

Full Sequence      

MKGLFTTLCLALAHFCQLTEAKSGSWSGTNNYFLQGMSDSAQDAYIQTLSSYDTKVVRLW
VNQASKGCQKGSQIVRDIPQLETTIGQYNKVTLDEIDKLLVKLSDKNIKAIISPHDANSL
IGDYRKDAYWARWGSGYFYEKQDAFDAYDARLSYILNYKGTYSGKVWKNWPTAIFSFNLQ
NEPMTPGPSNCKNGDPSGWACGRATFMRNAGLDSHILISTGGLGGDFSHGCTFLPAVTQC
KAIDAISVHRYASVPGMWSANLPNWLNQANGKKVYLEKWGVDSQQYDQKSVFVSEVNDMN
SAGLPNMYWQLLPPSSGGCSYNPKNDAGDPFGIYTNSGVNLAGPINGATSSGAAQDWTGS
LDVIRLPAAPRTIYLDATGIAKDDLIDLHLFIPSNRTLCTVNVRKLGDAAFSVVGNSETS
LRVLLESTNIPKVGFDIRDISRILFHRFKVSLGRVHDIQLLELASRNDGQQKKFLSGLTS
CIEQAISNEDPGKFRWHNPDDAKDLRFYQEFGHAPYWIMKRVEIFPVLWEVYNTKLSKPK
NAVWLHLAKQESEQRIHDAMKKRRKARTEKQSWGPEVFWDDQQKQIAKDVWKEGIMLNEL
MGDVEISQDDE

Enzyme Prediction     

No EC number prediction in FOIG_09741-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	47	313	1.9e-42	0.9717314487632509

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
99851	Egl_like_exo	1.54e-04	401	459	43	95	DEDDy 3'-5' exonuclease domain of Drosophila Egalitarian (Egl) and similar proteins. The Egalitarian (Egl) protein subfamily is composed of Drosophila Egl and similar proteins. Egl is a component of an mRNA-binding complex which is required for oocyte specification. Egl contains a DEDDy-type DnaQ-like 3'-5' exonuclease domain possessing three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. The motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. The conservation of this subfamily throughout eukaryotes suggests that its members may be part of ancient RNA processing complexes that are likely to participate in the regulated processing of specific mRNAs. Some members of this subfamily do not have a completely conserved YX(3)D pattern at the ExoIII motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62060.1|GH5	7.31e-266	1	361	1	361
QGI85699.1|GH5	5.64e-256	1	361	1	361
CCT72882.1|GH5	5.64e-256	1	361	1	361
QGI99394.1|GH5	5.64e-256	1	361	1	361
QGI68502.1|GH5	5.64e-256	1	361	1	361

PDB Hits     

FOIG_09741-t36_1-p1 has no PDB hit.

Swiss-Prot Hits     

FOIG_09741-t36_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000208	0.999730	CS pos: 21-22. Pr: 0.9821

TMHMM  Annotations     

There is no transmembrane helices in FOIG_09741-t36_1-p1.