CAZyme Information: FOIG_09615-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_09615-t36_1-p1
• CAZy Family: GH2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
555	JH658287.1|CGC8	59224.44	7.8147

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658287.1:151460-153127(+)

Full Sequence      

MLLSLILSVLAAHTGLALGDTSVTVNINKRLQVIDGFGVSEAYGHAKQFQNLGPGPQKEG
LDLLFNTTTGAGLSIIRNKIGCDDSNSITSTNTDNPAKQPVFHFDGDDDGQVWFSKQAMA
YGVEIIYANAWSAPLYMKSAKSMGRLCGTPGVSCTSGDWRHRYVEMIAQYLSYYKEAGIP
VSHVGFLNEGDGSDFMLSSAEQAADVIPLLHSALNSKGLGDIKMTCCDNIGWKSQMEYTA
KLAELGVESYLSVITSHEYSSSPDQSMNTTLPTWMSEGAANDQAFATAWYVNGGSNEGFT
WAVKIAQGIVNADLSAYIYWEGVETNNRGSLSHVIDTDGTKFTISSILWAIAHWSRHIRP
GAHRLSTSGVVQDTIVGAFENVDGSVVLVLTNTGTAAQTVDLGVTGRTFSTAQAFTSHAE
AQMVNTKVTLSDNRVKVTVPVHAVVTVKLTTARSSNAISAAISSQSTPTPANDGHSLVRQ
KPSSTTLSIVRAPTSAQTTSVVESAKAVKYPVPAVTPKSSKKSPAKKNSHQSHSAHGAAH
HRCGHGNHRRGRCTK

Enzyme Prediction     

No EC number prediction in FOIG_09615-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	21	447	2.1e-163	0.9909706546275395

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227807	XynC	6.32e-19	23	446	36	425	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
396577	Glyco_hydro_59	5.72e-09	54	356	20	293	Glycosyl hydrolase family 59.
407314	Glyco_hydro_30C	6.91e-05	361	411	1	52	Glycosyl hydrolase family 30 beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62186.1|GH30_7	0.0	1	555	1	555
CCT73001.1|GH30_7	0.0	1	555	1	560
QGI99497.1|GH30_7	0.0	1	555	1	560
QGI85808.1|GH30_7	0.0	1	555	1	560
QGI68607.1|GH30_7	0.0	1	555	1	560

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M5Z_A	3.08e-104	17	451	20	455	Chain A, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7O0E_A	4.00e-90	21	394	3	388	Chain A, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	7.29e-89	21	394	10	395	Chain AAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6IUJ_A	7.91e-81	9	405	6	426	Chain A, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	1.46e-78	20	405	92	497	Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2Q1N4|XY30A_MYCTT	5.42e-90	21	394	27	412	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
sp|O16580|GLCM1_CAEEL	4.73e-07	19	399	83	488	Putative glucosylceramidase 1 OS=Caenorhabditis elegans OX=6239 GN=gba-1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000212	0.999759	CS pos: 19-20. Pr: 0.8788

TMHMM  Annotations     

There is no transmembrane helices in FOIG_09615-t36_1-p1.