CAZyme Information: FOIG_09580-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_09580-t36_1-p1
• CAZy Family: PL4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408		44836.94	7.1873

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658287.1:58179-59567(-)

Full Sequence      

MRVSTISAIFSGLAVSATAQSDLDGSVWKALLAEPQSKRGFSDMPRNRPVKRQSGWNPPA
DLKAPLQEVWEHYEKTYDGGLDANVNTGFHQIMANKGYLNICVRWDSSATITEAQRTKIA
SAYNAQYQKWFKWLYGYNGFPYDEVKVNVVAYAVKDKSQLQGSTAGYEVYTELDADGVPM
CPVACARDAHLDGDYSGCKAGADRHYDHSLWLKDGLEGGFGHNWGQEVGREYFMNNLDSD
NIHILLHEMGHTFALDDYWTPTGVTKFIMLAGASMEITDFDGWMYRNWWYYLSQKNNWSS
SKSSSDAAPVSSESKPTVNTAAPVKAPTKTASPKPSTTTTKATVTKPTSTKKATATKAPM
APSTENSSVAEVAAWGQCGGNNWTGATKCASGTKCTKHNDYYSQCVAN

Enzyme Prediction     

No EC number prediction in FOIG_09580-t36_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395595	CBM_1	2.38e-13	374	402	1	29	Fungal cellulose binding domain.
197593	fCBD	4.00e-13	373	406	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
398885	BASP1	1.17e-04	306	365	177	225	Brain acid soluble protein 1 (BASP1 protein). This family consists of several brain acid soluble protein 1 (BASP1) or neuronal axonal membrane protein NAP-22. The BASP1 is a neuron enriched Ca(2+)-dependent calmodulin-binding protein of unknown function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62209.1|CBM1	1.91e-278	1	408	1	407
QGI99522.1|CBM1	1.01e-259	1	408	1	406
QGI85823.1|CBM1	1.01e-259	1	408	1	406
QGI68632.1|CBM1	1.01e-259	1	408	1	406
CCT73102.1|CBM1	4.25e-257	1	408	1	408

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q8M_A	7.62e-08	367	406	367	406	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
1CBH_A	9.90e-06	375	406	5	36	Chain A, C-TERMINAL DOMAIN OF CELLOBIOHYDROLASE I [Trichoderma reesei],2CBH_A Chain A, C-TERMINAL DOMAIN OF CELLOBIOHYDROLASE I [Trichoderma reesei],2MWJ_A Chain A, Exoglucanase 1 [Trichoderma reesei],2MWK_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X34_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X35_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X36_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X37_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X38_A Chain A, Exoglucanase 1 [Trichoderma reesei]
5X39_A	9.90e-06	375	406	5	36	Chain A, Exoglucanase 1 [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46239|GUNF_FUSOX	1.22e-09	367	406	14	53	Putative endoglucanase type F OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|P49075|GUX3_AGABI	3.36e-09	370	408	20	58	Exoglucanase 3 OS=Agaricus bisporus OX=5341 GN=cel3 PE=1 SV=1
sp|A0A024SH76|GUX2_HYPJR	1.43e-07	358	406	16	62	Exoglucanase 2 OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=cbh2 PE=1 SV=1
sp|P07987|GUX2_HYPJE	1.43e-07	358	406	16	62	Exoglucanase 2 OS=Hypocrea jecorina OX=51453 GN=cbh2 PE=1 SV=1
sp|I1S3C6|XYND_GIBZE	2.08e-07	367	406	13	52	Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=XYLD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.349057	0.650918	CS pos: 19-20. Pr: 0.5994

TMHMM  Annotations     

There is no transmembrane helices in FOIG_09580-t36_1-p1.