CAZyme Information: FOIG_08972-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_08972-t36_1-p1
• CAZy Family: GH17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345	JH658285.1|CGC6	35762.61	4.5657

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658285.1:435590-436627(-)

Full Sequence      

MHSSTTLLLLATATVNAIGIRDDCKDVHIFLAKGNNEPYPGRQGKLAGAICSGLKSCDYE
DIQFQNALEDPFCDSVTEGVKNGIKQITAYNKKCPDSKLVVSGYSQGGQVVGDILGGGGG
VFFQNCVEPDLQGLNPKTLPGSKIVAAMVFGDTRHTKDQPFNVLSGAGKNGLFPRPAGML
QNLASYGDVFRNYCVETDPICAQGDEVETHLNYFDVFTDDVAEWVKERIGEDATTTTAAT
KTSTKAKSTAKETSTKDAETESTTEAASTTKDASKDSTTKDTTTAAASTTADSSSTTDAS
SAEGRATAGEASSGAAAPSSTDNAATSKGASLMGMIIGVAALLAI

Enzyme Prediction     

No EC number prediction in FOIG_08972-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	24	228	9e-35	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	2.19e-25	24	229	2	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI65106.1|CE5	3.47e-176	1	345	1	346
CCT69066.1|CE5	3.47e-176	1	345	1	346
QGI95990.1|CE5	3.47e-176	1	345	1	346
QGI82360.1|CE5	3.47e-176	1	345	1	346
UPL04270.1|CE5	1.01e-125	1	229	1	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BS9_A	1.44e-13	24	230	2	207	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	1.44e-13	24	230	2	207	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	1.44e-13	24	230	2	207	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1QOZ_A	2.69e-13	37	213	31	190	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
4PSC_A	1.70e-06	22	157	77	198	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A2J8C362|CUTI1_VERDA	9.48e-17	4	229	3	229	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|O59893|AXE2_TALPU	3.76e-14	1	230	1	234	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	1.86e-12	6	213	7	221	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|P0A537|CULP3_MYCBO	6.16e-08	3	229	23	226	Probable carboxylesterase Culp3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=cut3 PE=3 SV=1
sp|P9WP38|CULP3_MYCTO	6.16e-08	3	229	23	226	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=cut3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000228	0.999755	CS pos: 17-18. Pr: 0.9802

TMHMM  Annotations     

There is no transmembrane helices in FOIG_08972-t36_1-p1.