CAZyme Information: FOIG_08474-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_08474-t36_1-p1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
834	JH658284.1|CGC5	92561.64	5.3130

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658284.1:271135-273639(+)

Full Sequence      

MAASQTTIELISKLTVEEKVSLLAAVDWWRTPTIKRDDVFIPHIKTSDGPNGARGESYVS
GITAACFPCSTAIGATFDSEQAYRLGKEIAKETKTKSANVLLAPTMNIIRSPLGGRNYET
YSEDPYLIGTLASAFVRGCQNEGIAATPKHFVANDSEKSRTKMTSNIDRQTLREIYMLPF
QLVMRDSDPWCFMTSYNRLNGEYCAEDHWLLEEVLRKEWGFSGLVVSDWMGTYSTAHALN
SGLDVEMPGPTRWRGQKVLKEIEAGNVTTKTLDKSVGRVIELARKTGRFEDPVEKPEHSV
EDPERLEFITSIAADGMVLLKNDNNILPLPSNASVAVIGHHALHPSIGGGGSAKVLAQHI
ISPLEGLKAQGVNCRHATGVPVFGALPHAEPETISPVQLRWFNSSVVGENLAHEQTITLP
EYMIKEAWPTYLEKEYCTIMSFNLRPTTSGGHVFSVITTGKADLLVNGEKVFHRPQEPVL
LPESFYFYKAKIERRFTLDMTAGQEYKIELQSWATDPEVLSKIGGTMFQGASLRFMEHVD
IPGAVQHAAEIAASSDVAVVFVGTTNELESEGYDRDTMDLTSDQYDLINAVVARNPRTVV
VNLSGSPVTVSPFIDQVPCFLQAWFAGQECGHAIARVLLGHVNPSGRLPMSWPKRNEDNP
AYVNFPCDDNLELNYEERLKVGYRFYDDETAPKPQFHFGEGLSYTTFELTGRASTSSRVD
TTETAETSLVTEVKNTGARDGKQVVQLYVTPPPCDGNPRPVKDLRSYCKVFVSAGQTEEV
TFKLDKYAFSYFDTAVDKWKMPQGEFRLHICFSSAETLQTVSVTNPETRYWTGL

Enzyme Prediction     

No EC number prediction in FOIG_08474-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	40	248	8.9e-64	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.06e-71	67	819	120	759	beta-glucosidase BglX.
224389	BglX	4.48e-66	41	370	60	386	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.65e-52	317	683	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.94e-45	67	282	88	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.90e-42	4	785	50	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60297.1|GH3	0.0	1	834	1	834
QGI87776.1|GH3	0.0	7	834	4	831
CCT75026.1|GH3	0.0	7	834	4	831
QGJ01306.1|GH3	0.0	7	834	4	831
QGI70417.1|GH3	0.0	7	834	4	831

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.11e-165	9	834	8	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	8.18e-162	9	834	8	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	5.74e-123	9	823	7	666	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.42e-110	4	824	2	662	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	3.03e-102	9	823	56	826	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WU49|BGLI_ASPFU	2.33e-182	11	834	10	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	2.33e-182	11	834	10	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	3.28e-182	11	834	10	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	5.15e-181	11	834	10	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	5.89e-180	11	834	10	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999972	0.000064

TMHMM  Annotations     

There is no transmembrane helices in FOIG_08474-t36_1-p1.