CAZyme Information: FOIG_08468-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_08468-t36_1-p1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
814	JH658284.1|CGC1	91646.82	6.1434

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658284.1:255615-258059(-)

Full Sequence      

MAAEQFDTSWMWNPAFIEKATSTAGRFVHFRKTFFVNKEIPTSLPLQITADTRYKLYVNK
QLAAFGPVKGDASLWFYDEVDISPYLRLGENHIAIHVLRLFHGTSYGTSFPRLGTGGVKI
ATTVDDEVWAPQIRSSELWKTAIDHNVTLRIDEEEDDFLHVYELVSASRDTSLEWIPAIP
LRFQDSTGVTAPWKLSPRLIPPMRGHKAYFSAIHNVQSDLPHGTWSAGLLGIQSADSNLL
LPARSSHQLDLETPVHTTAFIRFRFVRPEVGGACLTITYSESYENTPVLIPYLRCKGNRC
DSSKFLIGPKDIYTFRGKDGNPCLGYYDEEDTEEVYMPFHWRTFRFIRLTIETGSSDLIM
RGIDIDVVNYPLDVLSTISTTTDDGTLGALYDTSIRTLQNCMHECYEDCPFYEQLQYAMD
TRSSCLFTYHVSGDDRLARQAIVQLHSSFQPRIGLTASRAPSTQLQIIPHFSLYWICMLH
DHFLYYADKAFVRPLLPVVDAVLGFFHERMDHRLDLVSLGNEKGVWNFHDWAEQWRPYGI
PPSAANSGVSTYTNSLYAYTLKLAAKLQGECAGRLSLADEYSHRAGLIVDAVKRQCFDGQ
YFTDSIAACSDPKADRSQHNQVWAVLSGAVCGNSAQVLLKRALGSSQSGAPLIKTSISMS
FYTLRAISIAGGSLYDELFHVLWQPWRHQLSLGLTTWEEDDVSHRSDCHAWGSAPIYEFL
AEVAGIRPAKPGWQELEFAPRLGLYTSLEATVPFYREGKLVLAKVAWSSLDGETLVTLGI
EGLDESISVHVKLPGWPGMVEKSSQNMSFTWTRS

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	256	769	1.1e-83	0.9265873015873016
CBM67	9	145	1.5e-21	0.7329545454545454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	6.04e-08	381	717	7	334	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
397120	Glyco_hydro_2_N	6.81e-04	5	99	48	135	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60291.1|GH78	0.0	1	814	1	814
QGJ01319.1|GH78	0.0	1	813	728	1540
CCT75039.1|GH78	0.0	1	813	1	813
QGI87788.1|GH78	0.0	1	813	728	1540
QGI70430.1|GH78	0.0	1	813	728	1540

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	2.37e-33	342	794	503	942	Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	5.95e-06	334	717	164	536	Chain A, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

FOIG_08468-t36_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOIG_08468-t36_1-p1.