CAZyme Information: FOIG_08415-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_08415-t36_1-p1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
537		59557.15	6.2626

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658284.1:133356-134969(-)

Full Sequence      

MVPLLQDTPIATNSVLKIPSKPGDMARSDSSASSATEDERIARSETSWSEGAADSKEDDI
QEQKHALHKVLSELFEENIIAKPCRAASRVLQGLIPAHDGFPEIVPQQGPKQGQWEFREP
EFWTCGFFPGTLYALLERSIRYPGSLRADNPEHRSSTIIRNHLLPLCKSWSEPLHAMASR
TDTHDIGFIIMPALRRDWELFGTERSFASIVQAAHSLATRYVPAAGAIRSWDCLLKKDIT
VTDMENNLLVIIDSMCNLDLLFYAAAQTGEQRLANIAASHATTLLKTHLRPESVRSTAKH
GYQDQLYSTCHVANVDPQTGDLKWRRTAQGYADHSTWSRGQAWAILGYAQTYNWTKDERF
LDAACGCAEYFLYRLETSPSCVELPIETGRGHANPCRGRHVPLWDFDAPIENPQDPLRDS
SAGVIAANGMLLLSQSLAALGRHTMSRRFFDASIEIVKDTLDVCLATDKAKLTTSGNNGT
SINVADVVLGATFDALLKYGTANNNENARRRYANHGLVYGDYYLVEFGNLLLSMGLV

Enzyme Prediction     

No EC number prediction in FOIG_08415-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	118	526	7.4e-85	0.9726443768996961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271200	LanM-like	0.007	261	376	501	629	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60239.1|GH88	0.0	1	537	1	537
QGJ01387.1|GH88	4.84e-311	1	536	1	531
QGI70497.1|GH88	4.84e-311	1	536	1	531
QGI87852.1|GH88	4.84e-311	1	536	1	531
CCT75108.1|GH88	1.13e-309	1	536	1	531

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	5.53e-32	90	434	40	320	Crystal structure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	4.50e-25	86	375	31	282	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	4.56e-25	86	375	32	283	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3ANI_A	2.06e-24	86	375	32	283	Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]
3VXD_A	2.06e-24	86	375	32	283	Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_B Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_C Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_D Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KLZ3|PLH1_FORAG	6.39e-33	123	526	77	389	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
sp|Q9A0T3|UCDH_STRP1	2.88e-29	99	454	46	337	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
sp|Q8DR77|UCDH_STRR6	1.12e-27	85	430	29	313	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
sp|Q8E372|UCDH_STRA3	2.35e-24	86	375	32	283	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
sp|Q9RC92|UGL_BACGL	2.01e-23	101	453	20	310	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOIG_08415-t36_1-p1.