CAZyme Information: FOIG_06516-t36_3-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_06516-t36_3-p1
• CAZy Family: GH10
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540		58398.18	4.5952

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658280.1:418727-420398(-)

Full Sequence      

MKFSAAIVAAAATAASAKLEPITMKGSKLFYSNGTQFFMKGVAYQQDTAAAGETNDKTTK
YIDPLADEDACKRDIPLLKQLGTNIIRTYAINPKADHKACMKLLDDAGIYVISDLSEPSV
SINRDDPKWDVELYERYIGVVDELGQYDNVVGFFAGNEVSNNVSNTQASAFVKAAVRDTK
KHIKSKFSRWLGVGYASNDDVDIREQIADYFNCGDDDSRIDYWGYNIYSWCGKSSMQDSG
YADQAKFFENYSVPVFFAEYGCNEPDGAAGRIFDETTALYEEKVMTDVFSGGIVYMYFQE
ANDYGLVKISKNGDAVKQKDFAQLQKKANAAKPSGVEEDSYKPTGKAATCPEQSKNWRAN
SVLPPVPDSDLCDCMVKSRSCVPADNLKAKDFNDIFGYICGQDKKICTAINANATAGIYG
AYSMCSNEAKLAYILDAYYTSQKSAADACDFKGKATTQKAESQDSCKSALASASKINEEV
ATATHAVASSSTGGSNSSSEDDENFGLQAASIARVFSLGDFAVGAYMAVAGVVGAGMVLL

Enzyme Prediction     

EC	2.4.1.-:3	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	17	329	5.3e-128	0.9839743589743589
CBM43	380	467	5.3e-19	0.9879518072289156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	2.60e-146	18	327	8	310	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	2.54e-24	379	456	1	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	5.30e-16	380	468	2	85	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.
225789	LacZ	4.68e-04	28	174	291	422	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD48906.1|CBM43|GH72	0.0	1	540	1	540
AAX78216.1|CBM43|GH72	0.0	1	540	1	539
QGI67878.1|CBM43|GH72	0.0	1	540	1	540
QGI98764.1|CBM43|GH72	0.0	1	540	1	540
CCT72239.1|CBM43|GH72	0.0	1	540	1	540

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	2.84e-109	18	439	32	456	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	7.96e-109	18	439	32	456	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	7.96e-109	18	439	32	456	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ATC3|GAS1_ARTBC	2.07e-179	1	540	1	545	1,3-beta-glucanosyltransferase ARB_07487 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07487 PE=1 SV=1
sp|P0C956|GEL4_ASPFU	2.63e-157	26	473	43	486	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel4 PE=3 SV=1
sp|B0XVI5|GEL4_ASPFC	2.63e-157	26	473	43	486	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel4 PE=1 SV=1
sp|P56092|EPD1_CANMA	2.18e-156	13	473	19	468	Protein EPD1 OS=Candida maltosa OX=5479 GN=EPD1 PE=3 SV=1
sp|O74137|EPD2_CANMA	1.88e-149	13	469	16	477	Protein EPD2 OS=Candida maltosa OX=5479 GN=EPD2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000786	0.999193	CS pos: 17-18. Pr: 0.9237

TMHMM  Annotations     

There is no transmembrane helices in FOIG_06516-t36_3-p1.