CAZyme Information: FOIG_06282-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_06282-t36_1-p1
• CAZy Family: CE8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301	JH658279.1|CGC2	32702.48	4.4446

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658279.1:1366215-1367214(+)

Full Sequence      

MKMFSALLTGLYGSFLAHAYPVDHPAKFSRLIVFGDSFSDNGNGSWVVSNGTWPVDPAYY
HHSFSNGPKWNDVVAKQLNLELINLATGGATTNNDFVAGGTGAESTIPVPSAADQVLSFL
SWDKPQAGDIFVHWIGANDILFNTSITGGQITSLINENVNRLYQAGAKTIILANYLNATT
FPATYNSSTYNIPSVQDYVPALTKGLEQIAAGYSAYAKTAVIDVQDLFNDMFSDPEAYGF
DEDYVNPPTACLTGVYTSEGVPRHLCSDPEKHIFFDEYHPVKEVHALVAKLFVESIEGFS
A

Enzyme Prediction     

No EC number prediction in FOIG_06282-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	31	292	1.7e-24	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.31e-61	30	294	1	269	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	3.06e-24	31	296	3	315	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238883	Triacylglycerol_lipase_like	1.87e-21	28	289	1	274	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
225780	COG3240	1.67e-19	3	289	1	326	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
185279	PRK15381	2.53e-11	29	285	143	390	type III secretion system effector.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI61065.1|CE0	1.43e-217	1	301	1	301
QPC72470.1|CE0	4.97e-170	3	300	1	300
QPC63584.1|CE0	1.42e-169	3	300	1	300
UPL02629.1|CE0	1.49e-152	13	300	12	298
UJO20625.1|CE0	7.46e-113	26	297	29	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JL1_A	3.92e-21	21	290	137	404	Crystal structure of VvPlpA G389D from Vibrio vulnificus [Vibrio vulnificus]
6JL2_A	1.84e-20	21	290	137	404	Crystal structure of VvPlpA G389N from Vibrio vulnificus [Vibrio vulnificus],6JL2_B Crystal structure of VvPlpA G389N from Vibrio vulnificus [Vibrio vulnificus],6JL2_C Crystal structure of VvPlpA G389N from Vibrio vulnificus [Vibrio vulnificus]
6JKZ_A	3.42e-20	21	290	137	404	Crystal structure of VvPlpA from Vibrio vulnificus [Vibrio vulnificus],6JL0_A Crystal structure of VvPlpA from Vibrio vulnificus [Vibrio vulnificus]
6UQV_A	5.50e-16	18	290	1	279	Crystal structure of ChoE, a bacterial acetylcholinesterase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],6UQW_A Crystal structure of ChoE in complex with acetate and thiocholine [Pseudomonas aeruginosa PAO1],6UQW_B Crystal structure of ChoE in complex with acetate and thiocholine [Pseudomonas aeruginosa PAO1],6UQX_A Crystal structure of ChoE in complex with propionylthiocholine [Pseudomonas aeruginosa PAO1],6UQX_B Crystal structure of ChoE in complex with propionylthiocholine [Pseudomonas aeruginosa PAO1]
6UR1_A	1.41e-15	18	290	1	279	Crystal structure of ChoE S38A mutant in complex with acetate and acetylthiocholine [Pseudomonas aeruginosa PAO1],6UR1_B Crystal structure of ChoE S38A mutant in complex with acetate and acetylthiocholine [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q99289|HLT_VIBPA	6.22e-22	25	295	141	409	Thermolabile hemolysin OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=VPA0226 PE=1 SV=2
sp|P10480|GCAT_AERHY	3.19e-17	1	256	1	248	Phosphatidylcholine-sterol acyltransferase OS=Aeromonas hydrophila OX=644 PE=1 SV=3
sp|Q93X94|EXL6_ARATH	8.68e-13	27	296	26	338	GDSL esterase/lipase EXL6 OS=Arabidopsis thaliana OX=3702 GN=EXL6 PE=1 SV=1
sp|A7J2C6|AES1_HYPJE	8.01e-11	20	300	20	339	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1
sp|Q8VY93|GDL66_ARATH	3.58e-10	26	289	25	339	GDSL esterase/lipase At4g26790 OS=Arabidopsis thaliana OX=3702 GN=At4g26790 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000246	0.999728	CS pos: 19-20. Pr: 0.9820

TMHMM  Annotations     

There is no transmembrane helices in FOIG_06282-t36_1-p1.