CAZyme Information: FOIG_05970-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_05970-t36_1-p1
• CAZy Family: CE5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
769	JH658279.1|CGC6	83692.14	5.2959

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658279.1:498020-500464(-)

Full Sequence      

MKFLLLFLFTLLGSADARYWLEDIEHRGTAPYYPDKLYPVFRNVKDFGAIGDGVADDTTA
INAAISEGVRCIPGVCKGSTISPATVYIPAGTYLISNSLIDLYYTQIIGDPTNRPVIKAS
ASFSKQSFGLIDGNPYLSTGSLAWNSTNVFFRQIRNLVLDTTALPPDFHAVGIHWPSSQA
TAITNCVFQLSTVPGNQHTGLLIEEGSGGLLNDLYFFGGGNATVLGNQQFTARNLWFSNA
DVAIWMTWDWGWTFKSTVFKNCRVGIKMDDSSFGVGSITILDSWFENVDVAIATTRNSSQ
SISSTASLAMENVKFQNVNNVLMGPAGTDLARSAIAPVESAVFLMGHYTNWEGTFDATAL
YPLPFTRSQNLLDRNIYYERSKPQYEQVPGSSFISAKANGAYGDASHDDTQALNALFQYT
AAKGLIAYLDAGYYMVSDTIHIPPNARIVGEALASIIMGTGPNFGDLNKPRPVVQVGRPG
DVGHIEWLDTIVSTRGPTAGAVLIQYNLFAPGAPSGMWDVHARVGGFAGTYLQVSDCPAI
KGTNTVNPRCLAAYMSFHVTAFAGGLFTENCWFWVADHDLEDQKYQRVSIFAGRGVLVEA
QRGRIWLSASGSEHHVLYQYQLANTRDVYIGHAQTEQAYFQPMPVAQYPFPPVTALNDPN
FQQDCQNDPDPAGCNIGWGMRILNSSNVAVYGAGLYSFFTNYNDTCASNKSPGYCQARTL
SIEGTNAGTRFLGLTVVGTRIMVHRDGMDLAPASDNNSTFADTLALYVS

Enzyme Prediction     

EC	3.2.1.58:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	15	767	1.1e-241	0.9851351351351352

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	3.84e-82	41	267	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
227721	Pgu1	1.68e-04	43	94	84	125	Polygalacturonase [Carbohydrate transport and metabolism].
403800	Pectate_lyase_3	0.002	393	465	1	75	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD53170.1|GH55	0.0	1	769	1	769
QGI77988.1|GH55	0.0	1	769	1	768
QGI60800.1|GH55	0.0	1	769	1	768
QGI91702.1|GH55	0.0	1	769	1	768
CCT64478.1|GH55	0.0	1	695	1	694

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	4.62e-197	15	769	2	755	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	1.71e-173	19	767	26	755	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P49426|EXG1_COCCA	3.14e-199	13	764	33	781	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|D4B0V1|E13B_ARTBC	3.06e-171	13	767	37	873	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P53626|E13B_TRIHA	1.82e-46	22	734	28	723	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000263	0.999696	CS pos: 17-18. Pr: 0.9788

TMHMM  Annotations     

There is no transmembrane helices in FOIG_05970-t36_1-p1.