CAZyme Information: FOIG_05512-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_05512-t36_1-p1
• CAZy Family: CE4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383		42853.65	4.5996

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658278.1:688185-689336(+)

Full Sequence      

MFWPSRLFCIQLTVLVATVHGSSNDECDCYLTNGTNSAYYSRHSFYDYRNLGDYAGVPSP
VQNASRKAGVTSDYFNSDTWDDSWSIQDWSNRGKGVSLSGDATVLMINSPNNVYIEKNDD
KDAASDTFLTMRTMRLPGFQSAAEFESVSTYHYVSVRMLARATGSAGACMAIFTYLGGEE
LAAVQEADIEIMTRDPKNRVQYTNQPSFTEDGDDIPKATRNGTLPKGVEWDDWVVHRLDW
TPKRSTWYANGQEVASIEFQTPKDPAQIILNAWSDGGSWSGNMSLNGAAYMHIQWIDIVY
NVTKDNEEKRGFDGRRLESDAEQDGGLVRRDDSKGACKVVCSIDEADKAGETNILPKSAA
SHMLDMRYWTRMIVFGIMLLAYI

Enzyme Prediction     

No EC number prediction in FOIG_05512-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	82	298	1.4e-101	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	2.64e-57	76	296	5	207	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	1.61e-09	141	296	56	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
225182	BglS	1.38e-06	151	300	116	264	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
395585	Glyco_hydro_16	0.001	140	296	20	167	Glycosyl hydrolases family 16.
185693	GH16_laminarinase_like	0.002	231	296	158	232	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD50890.1|GH16_22	1.36e-286	1	383	1	383
CCT66306.1|GH16_22	1.03e-253	14	379	1	367
QGI79665.1|GH16_22	2.35e-232	1	379	1	350
QGI62498.1|GH16_22	2.35e-232	1	379	1	350
QGI93393.1|GH16_22	2.35e-232	1	379	1	350

PDB Hits     

FOIG_05512-t36_1-p1 has no PDB hit.

Swiss-Prot Hits     

FOIG_05512-t36_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000193	0.999810	CS pos: 21-22. Pr: 0.9821

TMHMM  Annotations     

There is no transmembrane helices in FOIG_05512-t36_1-p1.