CAZyme Information: FOIG_05129-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_05129-t36_1-p1
• CAZy Family: CE1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
613		69451.32	9.1880

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658277.1:1396602-1398676(+)

Full Sequence      

MSSATVSRKVLDEARNKRNRSVFLRDIIVIRLINAWWIATFFQPDEFFQSLEPAWDLAFG
SRSGAWLTWEWKHQLRTSLHPALFAGVYLIADFISSRILPIGILRAAILVAAPKALQAVI
AGLGDWYTWQLAVSIYGANSNVSFFALFLQLFNPWQWYCSTRTFSNSLETTLTVMALYYW
PWELVSAAQTTKENPKPTPVLKSLWSLRASLCLAALAVVLRPTNVLIWATIVFFTLTRIS
LQGSSPLTISTVFVLIREAILCGSLILVISIASDRLYFGFWTFPAYNFLNFNLSKSLAVF
YGRNPWHYYILQGLPLICTTSLPFAIMALYKSSAFASSTSQSNTLKTLAYTVFTTIGALS
LISHKEVRFIYPLLPALSILSAPVAASFFTFQPDATTNNPRPRPQIRNKHYLLAALGVNV
FLAGYLSFFHQTAPLNVLTYLRHEYERIHPDSVQLAQTSRFSVGPGKDEELFALFLMPCH
STPWRSHLVYPGLRAYALTCEPPLHTEPNTPERENYRDEADRFYDNPIPFLTSELFGPEK
PLAVPRYIVGFDGIEPWLQDFVKTPEAQALGLTQVRPVWKGFNGLFNEDWRRSGKMIVWD
TVIYDNAPPAKES

Enzyme Prediction     

No EC number prediction in FOIG_05129-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	27	488	3.1e-108	0.9845758354755784

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215437	PLN02816	1.72e-68	15	562	34	512	mannosyltransferase
281842	Glyco_transf_22	1.26e-64	27	488	6	413	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD58395.1|GT22	0.0	1	613	1	613
QGI84229.1|GT22	0.0	1	613	1	613
QGI97878.1|GT22	0.0	1	613	1	613
QGI66992.1|GT22	0.0	1	613	1	613
CCT71266.1|GT22	0.0	1	613	1	613

PDB Hits     

FOIG_05129-t36_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4IB63|GPI10_GIBZE	0.0	1	612	1	612	GPI mannosyltransferase 3 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI10 PE=3 SV=1
sp|Q4WPG0|GPI10_ASPFU	4.63e-152	24	599	55	645	GPI mannosyltransferase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi10 PE=3 SV=1
sp|Q2UH15|GPI10_ASPOR	7.68e-121	27	599	61	627	GPI mannosyltransferase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi10 PE=3 SV=1
sp|Q5BCB9|GPI10_EMENI	5.42e-113	27	599	56	565	GPI mannosyltransferase 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi10 PE=3 SV=1
sp|Q6BH65|GPI10_DEBHA	1.84e-83	27	599	49	546	GPI mannosyltransferase 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI10 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000005

TMHMM  Annotations     

Start	End
21	43
82	104
210	232
247	269
276	293
308	330
342	364
369	391
411	433