CAZyme Information: FOIG_05076-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_05076-t36_1-p1
• CAZy Family: CE1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435		50123.25	5.9444

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658277.1:1245969-1247541(+)

Full Sequence      

MIVFEIRTSAFITAAAVLTTSVNAWLPNTEPHALNERDNETFVYPLRTEPNNKRWLPATK
KIRGVNLGSLFIYEPWIDSQEWANTGCEGEKSDFDCVMNKGQDITDKNFQAHWKRWINQT
DLDEMLSYGLNTIRVPLGYWLKEDLVDDSEHFPKLTFGGWFGILDSTLWLGKRSRLLHHS
LNKFIAYANCKNSLHGVPGAQESNQPFTGQYAPTVGFYSDYNYGRAIEWLEWMTDIIHTK
KEYRNVGMLGLVNEPLNWDKAVDSLRKTYYPKACSAIRKVEDKLKVTSNNRLHIHMMGSL
WGSGKPTEFLRDTSFTAFDDHRYLKWDTSVEASHGAYIKKSCSDDRNTDGPTIVGEWSLA
VPDDVEKTDAWNPQTQKEFYTKWFSAQVHAYEENTLGWVFWTWEASLGDDYRWSYRDAAR
AGVIPKDLDSLPSVC

Enzyme Prediction     

No EC number prediction in FOIG_05076-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	101	416	9.7e-129	0.9966666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	3.17e-11	61	417	17	374	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK93324.1|GH5_15	5.26e-241	8	435	3	414
CCT71223.1|GH5_15	3.86e-203	7	416	2	324
QGI66947.1|GH5_15	3.86e-203	7	416	2	324
QGI97833.1|GH5_15	3.86e-203	7	416	2	324
QGI84184.1|GH5_15	3.86e-203	7	416	2	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	4.57e-17	51	435	3	396	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1EQP_A	5.93e-17	55	435	2	391	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PB1_A	6.18e-17	51	435	4	397	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PF0_A	6.18e-17	51	435	4	397	Chain A, Hypothetical protein XOG1 [Candida albicans]
3N9K_A	1.11e-16	51	435	3	396	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B6Q3|EXGB_EMENI	6.66e-155	24	431	16	403	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1
sp|Q0C8Z0|EXGB_ASPTN	1.98e-145	18	430	14	396	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1
sp|A1DGM6|EXGB_NEOFI	3.00e-141	14	431	7	393	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|Q2TZQ9|EXGB_ASPOR	5.14e-136	12	431	3	395	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgB PE=3 SV=1
sp|B0XRX9|EXGB_ASPFC	3.90e-133	14	416	7	378	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.045851	0.954111	CS pos: 24-25. Pr: 0.9130

TMHMM  Annotations     

There is no transmembrane helices in FOIG_05076-t36_1-p1.