CAZyme Information: FOIG_03527-t36_2-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_03527-t36_2-p1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
602		67699.46	6.4525

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658275.1:1084752-1086707(-)

Full Sequence      

MKFRKLSAAFLVSLLQAPQLVAAALNATETDTQLVISNDRLYAAVQKKGGAIVKLTLDGT
NLLGSPSGSTGIGPYLDCYCTPKGFWTPGSVAPEYKLFKGKDGKGKDYGGIVMSDTYTET
GQVLEQYWFLRDGETGLHTFSRVAYHNEEQPFLRNLQELRTLFRPNNDMWTHLLTNTKQY
APLPGKEAKEKQVVVQDATWYLGNTPNDPYVKQEADYFTKYTFQDSWRDIDAYGLFADGS
KTEDGDAYGAWLVMNTKDTYFGGPLHSDLVVDGILYNYISSNHHGDQTPNITNGFDRTFG
PQYFHFNRFPGETDILKAQADAAQYADPEWNADFYDSIAKHVPNYVPTKSRGSFEVKVDL
PKGAKNAIAVLAQSGVDFQDNVFDTKAYQYWANLDESGRATIPRVKSGTYRLTVYADNIF
GQYTQDKVKIKAGKTEKKNVRWREESAGKELWRIGTPDKTSGEYRHGFEPDTSKPLQPEQ
YRIYWANWDFVKDFPEGVNFKVGESDVGKDLNYVHWSVFGGKGNSVRPEQYVGDGNVNNW
TIAFDLKESQVKHKKHATFTVQLAGAKTAAGNTDIYNASEPHSNLKYTVNINGKDLEPWV
IP

Enzyme Prediction     

EC	4.2.2.23:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL4	23	602	0	0.9129746835443038

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199907	RGL4_N	4.62e-52	28	308	4	258	N-terminal catalytic domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold; the middle and C-terminal domains are both putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
199904	RGL4_M	3.82e-33	350	435	1	86	Middle domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle domain represented by this model and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
405387	fn3_3	9.11e-27	361	435	1	72	Polysaccharide lyase family 4, domain II. FnIII-like is domain II of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain displays an immunoglobulin-like or more specifically Fibronectin-III type fold and shows highest structural similarity to the C-terminal beta-sandwich subdomain of the pro-hormone/propeptide processing enzyme carboxypeptidase gp180 from duck. It serves to assist in producing the deep pocket, with domain III, into which the substrate fits.
199905	RGL4_C	1.79e-18	452	602	1	105	C-terminal domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
405384	CBM-like	3.19e-08	451	594	2	91	Polysaccharide lyase family 4, domain III. CBM-like is domain III of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain possesses a jelly roll beta-sandwich fold structurally homologous to carbohydrate binding modules (CBMs), and it carries two sulfate ions and a hexa-coordinated calcium ion.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD49944.1|PL4_3	0.0	1	602	3	604
QGI94046.1|PL4_3	0.0	1	602	1	602
QGI80329.1|PL4_3	0.0	1	602	1	602
QGI63162.1|PL4_3	0.0	1	602	1	602
CCT67126.1|PL4_3	0.0	1	602	1	602

PDB Hits     

FOIG_03527-t36_2-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U5P7|RGLC_ASPOR	3.42e-244	23	602	21	595	Probable rhamnogalacturonate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rglC PE=3 SV=1
sp|Q5AZ85|RGLB_EMENI	4.10e-244	13	595	8	584	Rhamnogalacturonate lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rglB PE=2 SV=2
sp|A5ABH4|RGLB_ASPNC	2.85e-243	20	601	16	592	Probable rhamnogalacturonate lyase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rglB PE=3 SV=1
sp|Q0C7K7|RGLB_ASPTN	1.35e-237	22	595	18	584	Probable rhamnogalacturonate lyase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=rglB PE=3 SV=1
sp|Q5B5P1|RGLC_EMENI	1.87e-236	22	602	20	591	Probable rhamnogalacturonate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000266	0.999686	CS pos: 23-24. Pr: 0.7722

TMHMM  Annotations     

There is no transmembrane helices in FOIG_03527-t36_2-p1.