CAZyme Information: FOIG_02192-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_02192-t36_1-p1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781		87307.70	5.7825

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658273.1:1663190-1665535(+)

Full Sequence      

MHLRDGMWLPAQDFRTEYAEDVYEITPSKDQQALNLLCPVKHIRSRGDTLNQPTLDIDIK
AEMDGVISIETTHWAGAQRKGPNFDLFPAGQPKVEGKIVKSDKGTTIQSGVLSATIHPDQ
HNFDIKFHSSDGKKHLTNLGNRSTGFAYSPAPSTPMQTGDMRDFKHYMFMQTTLSVGESV
HGLGERFGAWNKVGQNVILWNADGGTSSDQAYKNVSFWMSNRGYGVFVDNPGKVDFEIGS
ERCCRVQTTVEGQRLKMYIIYGDGPKDVLKKYTVLTGKANRVPSWSFGLWLTTSFTTNYD
ETTVNSFLEGMKSRGSPVDVFHYDCFWMKGFRWTDFVFDEERFPDPKGQITRLKESGLCK
KVCVWINPYIGQAGAAFKHAAEKGYLLKRKNGDIWQWDLWQAGMGLLDVTNPEACAWYTE
CLNGLFDKGVDALKTDFGERIPTLDVQWHDASVDPQKMHNYYAFMYNKLVYEALQKRYGE
KEAVLYARAACAGTQRFPLVWGGDCESTPEALAESVRGGLSMGLSGFTFWSCDIGGFEGS
PPPWIYKRWVAMGLLCSHSRLHGSNCFRVPWVVDNDDTTEEGCSRTLAKWTALKTRLMPY
IFSQAIESIEGGIPMSLRAVALEFPEDPTSWYLDRQFMVGSQLLAAPIYEESGEVEFYLP
KGTWTSYFTNEVKSGPGWFKEKHAFGTLPLYVRENTVLVLGSCKEVGADYDFANNVEVAL
YQASPGAKATVVDGEGNVVAELVVGQDGKLEGTDKLKGDYKVAEKGRDLKGDAPVSIESL
S

Enzyme Prediction     

EC	3.2.1.177:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	258	698	5.7e-117	0.9953161592505855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224418	YicI	0.0	20	736	13	707	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
236731	PRK10658	0.0	1	695	1	665	putative alpha-glucosidase; Provisional
269879	GH31_xylosidase_YicI	7.53e-169	277	597	1	308	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.
395838	Glyco_hydro_31	2.78e-152	258	698	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
236691	PRK10426	1.10e-73	177	696	81	621	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD56124.1|GH31	0.0	1	781	1	781
CCT70171.1|GH31	0.0	1	781	1	781
QGI66026.1|GH31	0.0	1	781	1	781
QGI83265.1|GH31	0.0	1	781	1	777
QGI96908.1|GH31	0.0	1	781	1	774

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F2H_A	5.16e-234	1	748	1	720	Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_B Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_C Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_D Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_E Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_F Structure of the YicI thiosugar Michaelis complex [Escherichia coli]
1XSI_A	6.10e-234	1	748	1	720	Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_A Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSK_A Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_B Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_C Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_D Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_E Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_F Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli]
1WE5_A	1.80e-223	3	748	3	720	Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_B Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_C Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_D Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_E Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_F Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli]
5F7C_A	1.23e-95	178	698	202	715	Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6JR6_A	1.55e-66	178	698	156	688	Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31434|XYLS_ECOLI	2.57e-233	1	748	1	720	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
sp|Q5AW25|AGDD_EMENI	6.38e-228	1	697	1	695	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1
sp|P96793|XYLQ_LACPE	7.42e-194	1	744	1	720	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
sp|Q9F234|AGL2_BACTQ	7.39e-66	93	732	81	705	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
sp|Q9P999|XYLS_SACS2	2.54e-57	174	726	108	649	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOIG_02192-t36_1-p1.