CAZyme Information: FOIG_02098-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_02098-t36_1-p1
• CAZy Family: AA5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514		58775.58	6.2657

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658273.1:1385377-1386921(-)

Full Sequence      

MDPLVAAELAKFDDSVAFRARPQHVHHTWARTFSSLPELFIQPESLPEVEKVVNLARRCR
RRLVTTGCGHSPSNITCTSSWLVNLDNFNRVLSVNKDTGVVTMEGGIRLYALCEELEKHG
LTMPNLGSINEQSISGAISTGTHGSSLRHGLMSEDILSLKVTMADGTTVYCSKDIKTDLF
RAALLSLGAIGIITEVSFQAVPAFTLKWEQSIDTDHKMFESWNRNLWTQSEFVRVWWFPY
TRRAVVWQAEQTDEEHRDPPQSGYDGSIGYYVYHNLLYLAQRVPRILPWVEWFVFGMQYG
FRNGTTSSAVQPSRKALLMNCLYSQFVNEWAIPLHKGPEALRRLSSWLNHLTPDDPDYVP
HNIPFSADGLYVHAPVEVRVSDTTLTSNVRPYLDITVENGPTLYLNATLYRPYLMDPPCH
ERYYEAFEWLMKDLGGRPHWAKNFRTTRPEIEAFYGKQLESFRAIRNDADPQGMFVGPWH
RETIMEDGEGLEFEEVEIRREKNRTGGVTTFGII

Enzyme Prediction     

EC	1.1.3.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	27	223	2.5e-25	0.4388646288209607

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273751	FAD_lactone_ox	7.49e-149	29	475	7	435	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.
397924	ALO	2.58e-101	196	481	1	257	D-arabinono-1,4-lactone oxidase. This domain is specific to D-arabinono-1,4-lactone oxidase EC:1.1.3.-, which is involved in the final step of the D-erythroascorbic acid biosynthesis pathway.
215258	PLN02465	4.25e-42	29	479	89	565	L-galactono-1,4-lactone dehydrogenase
223354	GlcD	8.35e-40	30	475	25	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
130737	GLDHase	4.55e-33	8	261	29	284	galactonolactone dehydrogenase. This model represents L-Galactono-gamma-lactone dehydrogenase (EC 1.3.2.3). This enzyme catalyzes the final step in ascorbic acid biosynthesis in higher plants. This protein is homologous to ascorbic acid biosynthesis enzymes of other species: L-gulono-gamma-lactone oxidase in rat and L-galactono-gamma-lactone oxidase in yeast. All three covalently bind the cofactor FAD.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO63154.1|AA7	8.28e-09	37	199	62	227
QBZ54840.1|AA7	2.42e-07	37	203	63	232
AEO56694.1|AA7	1.30e-06	82	199	121	238

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7A24_z	6.44e-28	8	246	90	331	Assembly intermediate of the plant mitochondrial complex I [Brassica oleracea]
4ML8_A	2.20e-10	34	347	45	352	Structure of maize cytokinin oxidase/dehydrogenase 2 (ZmCKO2) [Zea mays],4ML8_B Structure of maize cytokinin oxidase/dehydrogenase 2 (ZmCKO2) [Zea mays],4ML8_C Structure of maize cytokinin oxidase/dehydrogenase 2 (ZmCKO2) [Zea mays],4ML8_D Structure of maize cytokinin oxidase/dehydrogenase 2 (ZmCKO2) [Zea mays],4MLA_A Structure of maize cytokinin oxidase/dehydrogenase 2 (ZmCKO2) [Zea mays],4MLA_B Structure of maize cytokinin oxidase/dehydrogenase 2 (ZmCKO2) [Zea mays]
6EO4_A	1.07e-08	37	478	48	465	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6EO5_A	3.28e-08	37	410	48	368	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
4AUT_A	1.31e-07	29	205	24	203	Chain A, Decaprenyl-phosphoryl-beta-d-ribofuranose-2- Oxidoreductase [Mycolicibacterium smegmatis],4F4Q_A Crystal structure of M. smegmatis DprE1 in complex with FAD and covalently bound BTZ043 [Mycolicibacterium smegmatis MC2 155]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7SGY1|ALO_NEUCR	6.18e-234	13	513	27	549	Putative D-arabinono-1,4-lactone oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alo-1 PE=3 SV=1
sp|Q6CG88|ALO_YARLI	5.74e-115	20	476	9	514	D-arabinono-1,4-lactone oxidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ALO1 PE=3 SV=1
sp|Q6CSY3|ALO_KLULA	3.02e-108	14	476	4	511	D-arabinono-1,4-lactone oxidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=ALO1 PE=3 SV=1
sp|O93852|ALO1_CANAL	1.52e-107	25	476	17	543	D-arabinono-1,4-lactone oxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALO1 PE=1 SV=1
sp|Q6FS20|ALO_CANGA	1.88e-106	14	476	2	509	D-arabinono-1,4-lactone oxidase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=ALO1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOIG_02098-t36_1-p1.