CAZyme Information: FOIG_01890-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_01890-t36_1-p1
• CAZy Family: AA4
• CAZyme Description: chitosanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235	JH658273.1|CGC4	24915.49	4.6337

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658273.1:749617-750421(-)

Full Sequence      

MHSYSLLTTFTLGTVATAYQLPQNLKSIYDNYKAGSCSNRLSDRFPEGARYCGDVPGAIF
LKGSNGNYDNMDIDCDGANNHAGACSNDPSGQGETAFKDTVNQYGIPDLDANVHPYVVFG
NDGASPSFDPQQHGIKPLSVMAVVCNGEVHYGIWGDTNGGTSTGEASISLAELCFPNEGL
NGDMGHGEKDVLYIAFKGEEAVPGKNGADWKATSRADFSKSIRALGDKLVVKLQG

Enzyme Prediction     

EC	3.2.1.132:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	8	230	1.7e-85	0.9727272727272728

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	2.60e-102	71	230	1	163	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI66296.1|GH75	4.48e-163	1	235	1	235
QGI97180.1|GH75	4.48e-163	1	235	1	235
QGI83540.1|GH75	4.48e-163	1	235	1	235
QKD56405.1|GH75	2.33e-154	1	233	1	227
CCT70428.1|GH75	3.95e-145	1	235	1	252

PDB Hits     

FOIG_01890-t36_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	6.26e-105	15	233	15	240	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q875I9|CSN_ASPFM	2.82e-100	9	234	8	237	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1
sp|Q2U1H5|CSNB_ASPOR	6.29e-100	12	234	11	240	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	1.12e-96	12	234	11	244	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	1.12e-96	12	234	11	244	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.176381	0.823611	CS pos: 18-19. Pr: 0.7610

TMHMM  Annotations     

There is no transmembrane helices in FOIG_01890-t36_1-p1.