CAZyme Information: FOIG_01634-t36_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_01634-t36_1-p1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530		61961.11	5.7098

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658273.1:160802-162668(+)

Full Sequence      

MTTGILKTDSDRIVDANGDAVLLRGTALGGWMLMENFMNGFPGREHQIRAALLKVLGQEK
HDFFFDKFLEYFFGEKDAEFLASLNFNCLRLCLNYRHFEDDMNPFVIKEEGFKHVDRVIN
LCAKYGIYTILDLHALPGGQNQDWHCDNPTGYAAFWDHKHFQDRAINLWEHIARRYKGNP
WVAGYNPMNEPADSEWSRLLAFYDRIVPAIRNVDPDHILFLEGNTFSMDFTGFDRVWDNS
VYAIHDYCGFGFPNRIGRFQGTKEQESYIRRMYDRKVEFMNKHNVPIWNGEFGPIYERKE
YNPDWEVQNQERYNMLDRQMAIYTSESIAWSIWAYKDVNVMGMTHVSPDSAWLKLLGPII
KKKRDLAVDSWAYDDAHLQDGLFGPLHQWFEDNVPTQYSKKYPWQWRMHMHVFRGIRGIT
MAEYMIPEWADYFKDKSFEELDELAASWKYENCMQREQLNELLKTYAPMKAGDRRLEGKV
IESEGTASDVASKEASVSGVGIFELSPEEKLKAELKKQQHPQAQPVPVAA

Enzyme Prediction     

EC	3.2.1.4:2	3.2.1.37:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	49	338	8.7e-129	0.9965034965034965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	2.40e-25	80	293	32	237	Cellulase (glycosyl hydrolase family 5).
225344	BglC	3.48e-16	71	227	72	229	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD56633.1|GH5_22	0.0	1	530	1	530
QGI97388.1|GH5_22	0.0	1	530	1	530
QGI66500.1|GH5_22	0.0	1	530	1	530
QGI83743.1|GH5_22	0.0	1	530	1	530
CCT70659.1|GH5_22	0.0	1	530	1	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEN_A	1.76e-18	72	339	28	319	Chain A, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
1CEC_A	1.76e-18	72	339	28	319	Chain A, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
7EC9_A	1.46e-16	73	264	37	229	Chain A, Endoglucanase [Thermotoga maritima MSB8],7EC9_B Chain B, Endoglucanase [Thermotoga maritima MSB8],7EFZ_A Chain A, Endoglucanase [Thermotoga maritima MSB8],7EFZ_B Chain B, Endoglucanase [Thermotoga maritima MSB8]
1VJZ_A	2.07e-15	73	264	37	229	Crystal structure of Endoglucanase (TM1752) from Thermotoga maritima at 2.05 A resolution [Thermotoga maritima]
6UJE_A	2.36e-14	81	300	40	260	Chain A, Endoglucanase [Clostridioides difficile],6UJF_A Chain A, Endoglucanase [Clostridioides difficile]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	2.93e-177	6	471	4	473	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|P0C2S3|GUNC_ACETH	2.05e-18	72	339	28	319	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
sp|P16169|GUNA_RUMFL	3.41e-18	22	295	7	262	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
sp|A3DJ77|GUNC_ACET2	3.71e-18	72	339	28	319	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
sp|P23340|GUNC_CLOSF	3.71e-18	72	339	28	319	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOIG_01634-t36_1-p1.