CAZyme Information: FOIG_00937-t36_2-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOIG_00937-t36_2-p1
• CAZy Family: AA1|AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511		58068.84	4.9616

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FodoratissimumNRRL54006	16975	1089451	341	16634

• Gene Location: location=JH658272.1:2695707-2697298(-)

Full Sequence      

MAPKGLGWIIIDSLDTMILMNLTSRVQDARHWISDSLTWDQDQDVNTFETTIRMLGGLLS
AHYLSTEFPGLAPLAEDDEGAAGEDLYLEKAKDLADRLMSAFDSPSGIPYASVNLAKFEG
IPSHADMGASSTAEATTLQLEFKYLAKLTGEKDFWDRVENVMKLVDNQGAQDGLVPIFIY
ATSGEFRGENIRLGSRGDSYYEYLIKQYLQTNKQEPIYQDMWYEALQGVRKHLVTYTSNS
KFTIIGERPNGLEMPLSPKMDHLVCFMPGTIALAATEGLTEAQARKLPTWSKKNEEDMQL
AREVMETCWRMYKYMATGLSAEITYFEIDNPPTAYGNPRNGPVNFDTSPDAEWRKDFTVK
SGDVHNLQRPETVESLFYMWRITNDNRYREWGWEMFKSFMNHTAVRNGGGFTSLRNANVV
PPKVRDNMESFWLAETLKYFYLLFSPPDLLPLDKVVINTEGHPLPRFDMGQLFSTGWKRK
PRDANGKIIATAVKVESKEKEAVMQDAKKVN

Enzyme Prediction     

EC	3.2.1.113:99

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	5	466	8.9e-155	0.9260089686098655

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	4	466	31	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.78e-148	4	468	108	520	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD47529.1|GH47	0.0	1	511	179	689
CCT62324.1|GH47	0.0	1	511	144	654
QGI89691.1|GH47	0.0	1	511	179	689
QGI75998.1|GH47	0.0	1	511	179	689
QGI58781.1|GH47	0.0	1	511	179	689

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1DL2_A	7.53e-135	3	477	41	509	Crystal Structure Of Class I Alpha-1,2-mannosidase From Saccharomyces Cerevisiae At 1.54 Angstrom Resolution [Saccharomyces cerevisiae]
1G6I_A	1.10e-134	3	477	75	543	Crystal structure of the yeast alpha-1,2-mannosidase with bound 1-deoxymannojirimycin at 1.59 A resolution [Saccharomyces cerevisiae]
5KIJ_A	1.45e-119	5	465	42	450	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	1.76e-119	5	465	47	455	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	1.87e-119	5	465	47	455	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8J0Q0|MNS1_CANAX	2.56e-159	1	480	73	522	Mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Candida albicans OX=5476 GN=MNS1 PE=3 SV=2
sp|P32906|MNS1_YEAST	5.10e-133	3	477	74	547	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNS1 PE=1 SV=1
sp|Q9P7C3|MNS1_SCHPO	2.83e-122	4	468	84	513	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E1P5.01c PE=1 SV=2
sp|Q93Y37|MNS3_ARATH	5.95e-121	5	465	166	619	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 OS=Arabidopsis thaliana OX=3702 GN=MNS3 PE=1 SV=1
sp|Q9UKM7|MA1B1_HUMAN	9.79e-116	5	465	286	694	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000019

TMHMM  Annotations     

There is no transmembrane helices in FOIG_00937-t36_2-p1.