CAZyme Information: FOC4_g10015199-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10015199-t38_1-p1
• CAZy Family: GT66
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
674	KB726996|CGC19	73316.81	8.0052

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726996:3615756-3617834(-)

Full Sequence      

MRNVGLESTINTVEVRDLPGAFSCSDNILNDIWKLGARATIDSCLGKSTQPAVWQIDPNN
GAYVANQRPAMTIEGHSFTNYTLEFDAFIDRGGFWWAVAQPLALDGLHIQLTGEMPSRSS
FANTNNTVTPPNTLLLASGFGFVNQTTLPSYILASTKIPFSVKEKTWYRIKTVLGGEGKL
EISVDGREVLKVNLTNYAPGGKPVSTTGPFGFGAWQDQAAYFRNAIAYDTANKSVIYRNP
LTSPETLVEYGTQENLGTVCLDGPKRDRLVWLGDFYHTSRIIGASTGGFNYTRGTFDFLL
QTQIRSGQIAIAPYLGYDPTKTGTLSLERVYGLDDYQLLGFLAFAHYIRQTNDLQYARKT
WSQWEKQLSWLASNINSTSGLADFGFTFLGAAQGGSLGSCATVETLNAAADIAEAIGKKT
SPKYRKLATDLARSVNQKLWNKALGTYGYALGDLNTSSVAGTAFCLSSDVASKERAVSAV
AALDELQLGLGYKDRSTLDDHGIDTKISPNTNGLLLQAILAGEDWDRAAKLIYNVWGAML
KNPETRSGASWEYLTPAGQPGLGAFTSLGHPWGGAATYILTEWVAGLRSADGIQGFGYKN
WVVNPELGAHMGLSHASAKVPLYPSGELEVKWSIKSKKMTVQIKAPPETKGVFRIGKTKK
TLENDSSYQFTIQL

Enzyme Prediction     

No EC number prediction in FOC4_g10015199-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	247	652	2.1e-54	0.746031746031746

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	8.29e-08	217	575	1	331	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	1.91e-04	597	650	8	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
225922	SGA1	0.007	262	464	277	485	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD47609.1|GH78	0.0	1	674	158	831
QGI58704.1|GH78	0.0	1	674	158	831
QGI89614.1|GH78	0.0	1	674	158	831
CCT62249.1|GH78	0.0	1	674	158	831
QGI75923.1|GH78	0.0	1	674	158	831

PDB Hits     

FOC4_g10015199-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

FOC4_g10015199-t38_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000002

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10015199-t38_1-p1.