CAZyme Information: FOC4_g10014315-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10014315-t38_1-p1
• CAZy Family: GT34
• CAZyme Description: Acetylxylan esterase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
223		23619.27	6.8769

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726996:776228-777095(+)

Full Sequence      

MLLILRYLILFVTFVTCQEYGQPVNASCVSGAHITVARGSLELRGPGIIGAVAQQVLQRI
PHSEMISLEYPAIYNPYQPSQMEGVAALSVVLAQYVTVCPKTKIILLGFSQGAHVIADVM
CGASSIGFLPTKPSPSAITNNIAAVVLMGDPSTTKGQPFHVGSSVGNGKPEGCQCVSDKT
VSFCDAGDPFCEAGGHDLRTHMNYVTAYGHVAVDYAVGMFHRT

Enzyme Prediction     

No EC number prediction in FOC4_g10014315-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	32	218	5.1e-41	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	2.41e-32	28	218	1	171	Cutinase.
223477	YpfH	0.006	100	151	97	158	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT62943.1|CE5	2.53e-146	1	222	1	227
QGI90331.1|CE5	1.37e-138	1	217	1	222
QGI59422.1|CE5	1.37e-138	1	217	1	222
QGI76630.1|CE5	1.12e-137	1	217	1	222
UPK99293.1|CE5	1.66e-102	1	222	1	224

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BS9_A	1.64e-23	33	215	6	201	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	1.64e-23	33	215	6	201	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	6.34e-23	33	215	6	201	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1QOZ_A	1.74e-22	33	215	6	201	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59893|AXE2_TALPU	7.71e-23	21	215	22	228	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	5.06e-22	21	215	20	232	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	8.81e-21	21	215	18	224	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|P9WP42|CULP1_MYCTO	2.53e-15	21	205	27	197	Carboxylesterase Culp1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2037 PE=3 SV=1
sp|P9WP43|CULP1_MYCTU	2.53e-15	21	205	27	197	Carboxylesterase Culp1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000218	0.999759	CS pos: 17-18. Pr: 0.9800

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10014315-t38_1-p1.