CAZyme Information: FOC4_g10013757-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10013757-t38_1-p1
• CAZy Family: GT24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404		46290.12	8.7858

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726993:1825456-1826882(-)

Full Sequence      

MLLPGGGLNWKAAKAQMPPSRVLRSNLTRSRLLLLIGVTGIVMLLYRTFRAPPPGPQNVR
CWGPNKSPMEMTPNEHALWNAHMQTPVLFNHHKPLKVESPSIQHIDLNPITSSPQALIRN
ERVLILTPLKDAAPFLKNYFKLIAELTYPHRLIDLAFLISDSKDDTLAVLASELDHLQKR
KDEVPFNSITVVEKNFHFHLSQDAEQRHGFEVQAPRRKAMAKARNYLLATALKPEHSWVY
WRDVDIEQAPRRIIEDFVAHDRDILVPNIWFHRFEKGVDIEGRFDYNSWIESDKGRKLAN
SLPKDTVIVEGYKEFDTGREYMCKMGDWRENKDVEVQLDGIGGVNILVKADVHRSGINFP
AYAFENQAETEGFAKMAKRAGYQVIGLPNYIVWHYDTQEKGGNL

Enzyme Prediction     

No EC number prediction in FOC4_g10013757-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	101	362	4.9e-106	0.9813432835820896

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	4.33e-156	101	363	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI95386.1|GT62	1.78e-304	1	404	1	404
QGI64501.1|GT62	1.78e-304	1	404	1	404
QGI81760.1|GT62	1.78e-304	1	404	1	404
CCT68569.1|GT62	1.78e-304	1	404	1	404
QKD54422.1|GT62	1.03e-303	1	404	1	404

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	1.12e-64	102	398	6	303	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74745|ANP1_SCHPO	6.29e-91	121	394	98	371	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P32629|ANP1_YEAST	6.52e-90	88	394	48	354	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|P23642|VAN1_YEAST	3.20e-74	101	394	171	511	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|P53697|MNN9_CANAL	2.60e-73	102	396	73	367	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1
sp|Q00314|VAN1_CANAX	5.62e-72	101	399	75	424	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000010

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10013757-t38_1-p1.