CAZyme Information: FOC4_g10013728-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10013728-t38_1-p1
• CAZy Family: GT22
• CAZyme Description: Chitin synthase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1394		155927.03	6.8681

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726993:1709492-1717141(-)

Full Sequence      

MAYNGRDQEYGGHALQDLPAGGSQYHLPPQENDEEQGRGLLNSGYDQDRLGARTPPDRPV
SAYSLTESYAPGASSTMPGQGPTGYGDGGSFGQFGNLDAAAPFPRPDSAFDPEDSWVERQ
QQPQMGGGLGRSKTRKIKLVQGSVLSIDYPVPSAIKNAVQPQYRDAESGTEEFHKMRYTA
ATCDPNDFTLKNGYDLRPRMYNRHTELLIAITYYNEDKVLLARTLHHTMQNIRDIVNLKK
STFWNKGGPAWQKIVVCLVFDGIDKADKNTLDVLATVGVYQDGVIKKDVDGKETVAHIFE
YTSQLSVTPNQQLIRPTNEGSQNLPPVQMIFCLKQKNTKKINSHRWLFNAFGRILNPEVC
ILLDAGTKPSPRSLLALWEGFYNDKDLGGACGEIHAMLGKGGKKLFNPLVAVQNFEYKIS
NILDKPLESSFGYVSVLPGAFSAYRFRAIMGRPLEQYFHGDHTLSKMLGKKGIDGMNIFK
KNMFLAEDRILCFELVAKAGQKWHLSYIKAAKGETDVPEGAAEFISQRRRWLNGSFAATL
YSLMHFGRMYKSGHNIIRMFFLHIQLIYTTLNTLFAWFSLGSYWLTTSVIMDLVGTPKAT
SGQHAWPFGDTGTPVVNALLQYLYLAFVMLQFILALGNRPKGSKFTYIASFMVFSLIQGY
ILVLSAYLVVRAFDTPIGDQISFASTDAFLDSFFGGSSAGGVILVALITIYGLNFVASFM
YLDPWHMFHSFVSSFPYYLLLMSTYINILMVYAFNNWHDVSWGTKGSDKAEALPSAHVTK
GEKNEVVVEEVEKEQEDIDSQFEQTVRRALAPFKEEEEVEKADVEDGYKSFRTGLVVSWL
FGNILLIVCITSDKFDNLGWGEPATERKAHYFQFLLYATAVLSLHDLILLATEFSVFTTN
LSESCSATCPTLSYNLTFVSCLGSRTPFSVISSRVFPQRIATQPKPGPPTSTMLKIWSMK
KEQKEAENAEGQATGGKKKKVTAAQLRVQKGMLHPVQTLTCSGVFRMKRLTHAATDLSEL
SLGSTMKTEFPDPDDILNFVLTIDPDEVEKEQEDIDSQFEQTVRRALAPFKEEEEVEKAD
VEDGYKSFRTGLVVSWLFGNILLIVCITSDKFDNLGWGEPATERKAHYFQFLLYATAVLS
LHDLILLATEFSVFTTNLSESCSATCPTLSYNLTFVSCLGSRTPFSVISSRVFPQRIATQ
PKPGPPTSTMLKIWSMKKEQKEAENAEGQATGGKKKKVTAAQLRVQKDLSELSLGSTMKT
EFPDPDDILNFVLTIDPDEGMYRGSRFTFDFTINQNFPHEPPKVRCREKIYHPNIDLEGK
VCLNILREDWKPVLNLNAVIVGLQFLFLEPNASDPLNKEAAEDLRNNREGFKRNVRTAMG
GGVVKGRTYDRVLK

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	213	381	4e-70	0.9938650306748467
GT2	358	574	7.7e-23	0.3946869070208729

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	1.08e-95	213	381	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	5.26e-92	209	538	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
395127	UQ_con	5.96e-46	1244	1379	1	139	Ubiquitin-conjugating enzyme. Proteins destined for proteasome-mediated degradation may be ubiquitinated. Ubiquitination follows conjugation of ubiquitin to a conserved cysteine residue of UBC homologs. TSG101 is one of several UBC homologs that lacks this active site cysteine.
227410	COG5078	8.31e-42	1237	1379	2	147	Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones].
238117	UBCc	1.40e-37	1244	1376	3	138	Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain. This is part of the ubiquitin-mediated protein degradation pathway in which a thiol-ester linkage forms between a conserved cysteine and the C-terminus of ubiquitin and complexes with ubiquitin protein ligase enzymes, E3. This pathway regulates many fundamental cellular processes. There are also other E2s which form thiol-ester linkages without the use of E3s as well as several UBC homologs (TSG101, Mms2, Croc-1 and similar proteins) which lack the active site cysteine essential for ubiquitination and appear to function in DNA repair pathways which were omitted from the scope of this CD.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHG06593.1|GT2	0.0	1	1394	1	1394
QPC68666.1|GT2	0.0	1	1394	1	1126
QKD54392.1|GT2	0.0	1	884	1	880
QGI95364.1|GT2	0.0	1	884	1	879
QGI64479.1|GT2	0.0	1	884	1	879

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NVU_C	1.33e-60	1236	1394	22	180	Chain C, NEDD8-conjugating enzyme Ubc12 [Homo sapiens]
1Y8X_A	3.24e-60	1239	1394	5	160	Chain A, Ubiquitin-conjugating enzyme E2 M [Homo sapiens]
4P5O_G	1.14e-59	1236	1394	25	183	Structure of an RBX1-UBC12~NEDD8-CUL1-DCN1 complex: a RING-E3-E2~ubiquitin-like protein-substrate intermediate trapped in action [Homo sapiens],4P5O_I Structure of an RBX1-UBC12~NEDD8-CUL1-DCN1 complex: a RING-E3-E2~ubiquitin-like protein-substrate intermediate trapped in action [Homo sapiens]
3O2U_A	2.38e-37	1238	1393	27	188	S. cerevisiae Ubc12 [Saccharomyces cerevisiae],3O2U_B S. cerevisiae Ubc12 [Saccharomyces cerevisiae]
2EDI_A	1.28e-25	1231	1375	5	158	Chain A, NEDD8-conjugating enzyme UBE2F [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92197|CHSC_ASPFU	0.0	114	884	106	871	Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsC PE=3 SV=2
sp|P30602|CHS3_EXODE	0.0	9	863	4	866	Chitin synthase 3 OS=Exophiala dermatitidis OX=5970 GN=CHS3 PE=3 SV=2
sp|Q00757|CHSB_EMENI	0.0	12	884	19	894	Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsB PE=2 SV=2
sp|P54267|CHSG_ASPFU	0.0	1	884	1	889	Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsG PE=2 SV=2
sp|P29070|CHS1_NEUCR	0.0	1	883	1	894	Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000009

TMHMM  Annotations     

Start	End
559	581
614	636
648	670
700	722
735	754
831	850
870	892