CAZyme Information: FOC4_g10010900-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10010900-t38_1-p1
• CAZy Family: GH78
• CAZyme Description: Putative pectin lyase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	KB726992|CGC4	39652.79	9.3518

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726992:2050135-2052787(-)

Full Sequence      

MKFTLCLSALTALLTSVTAQKVSAQGFAQGVTGGGSAAAVTPKNIQELVTYLTDKTPRVI
VLDRTYDFIGSEGTVKEKGCAPWKTGAGCQLAINAAGNWCGNNPKVDVTYSKAGTSGINV
ASDKTIIGVGNKGIIKGKGLRFVNVKNIIVQNIHVTNLNPQYVWGGDAFTFSGTSKIWVD
HCTTSLLGRQHYVFGRDKSTGITLSNNHIDGRTQWSAGCDGYHYWTIEMVGQGDQITLQN
NLIEHTAGRGPALSATTFLHAVNNVWRDINGHAIEGDTAGKGLFEGNVFQNVKQVVVPDF
KGQLNSCPDNAAASATQQYLGRVCQGNIFISSGAFNRKDTGFLSEFKGLPIARSTQATTA
QSKVPGNAGFGKI

Enzyme Prediction     

EC	4.2.2.10:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	108	291	4.6e-79	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.92e-50	107	293	1	190	Amb_all domain.
226384	PelB	6.41e-16	3	291	5	275	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	9.93e-09	91	289	4	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT66530.1|PL1_4	2.48e-273	1	373	1	375
CEF77859.1|PL1_4	2.89e-272	1	373	1	375
QPC59181.1|PL1_4	1.67e-271	1	373	1	375
CEI61602.1|PL1_4	2.37e-271	1	373	1	375
CZS81153.1|PL1_4	3.37e-271	1	373	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	2.33e-120	23	373	6	359	Pectin Lyase A [Aspergillus niger]
1IDJ_A	2.30e-115	23	373	6	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1QCX_A	2.43e-112	23	372	6	359	Pectin Lyase B [Aspergillus niger]
3VMV_A	1.14e-09	101	373	59	325	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QW65|PELC_ASPNC	1.26e-137	10	373	11	373	Probable pectin lyase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelC PE=3 SV=1
sp|Q5MBK3|PELC_ASPNG	1.22e-136	10	373	11	373	Probable pectin lyase C OS=Aspergillus niger OX=5061 GN=pelC PE=3 SV=1
sp|Q2UCT7|PELC_ASPOR	3.13e-136	14	373	17	375	Probable pectin lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelC PE=3 SV=1
sp|B8N6W5|PELA_ASPFN	3.13e-136	14	373	17	375	Probable pectin lyase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelA PE=3 SV=1
sp|A1CFS2|PELA_ASPCL	7.00e-131	9	373	8	378	Probable pectin lyase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=pelA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000214	0.999751	CS pos: 24-25. Pr: 0.9281

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10010900-t38_1-p1.