CAZyme Information: FOC4_g10010860-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10010860-t38_1-p1
• CAZy Family: PL4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
668		75018.61	7.8132

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726992:1947325-1949331(-)

Full Sequence      

MAAKSNNPFWSNEDPSCEDLSLPCHARLDSSVPDLYPDQTRSALPISPSNLSLDNPFATP
PSSPSISPISTPPPAISSDRSARKVGIYGPSSPSQTSLSSLSDERPAKNLLRPESSPQST
KKPSLWTRLWSSLNNQFSPNALWELINPKEYIYPMTLKKGAALAFVMSCVAALVISNWFT
GWMGKAIAQTRSYMLPVLVIVLTLEPLMFLIILSIARVPPYNPPKTTPSHVTEGVISEKS
PDDLERGVAVTTTGIWETAFVIPCHNSDREALRKVIESAYPHFRPQDIFIIDNGRSRYPQ
DLSFRYWLKNLHPDLVYIWSPIGSKNAAQLVGSLAAKDYKYILTTDDDVSLPENYRHPIH
LMNDHLRAVAFPLAGTDADGNTPLGMVSWQDCEYRMAGLVKLAENRTCGVNFPHGAGWFV
DRDVFVELLSKYHPMDFIAEDANAGFSIMRLGKGIAFDAQVTLATEVPATVLGPGLNWCK
QRIKSWEMGRHSLIWKIMRHLFRMNGQRTIQGILMQKGLFLYILACLVIDWVRIPVLVAL
GAHKEYWIFFFSLAFVACLPPLLYNYISCWHRPDMRIGLVTIATYPIYKQLYSFVSVFGA
VRWALFYIGGHVRAKPIRKMLKDGDEACFWLDPRFETNPAWLADEKEKMLADEMAMTEVA
SYSSSSQL

Enzyme Prediction     

No EC number prediction in FOC4_g10010860-t38_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224136	BcsA	2.30e-10	259	618	57	418	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	2.26e-07	261	441	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
132997	Glyco_tranf_GTA_type	7.91e-06	261	375	2	116	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
133056	GT2_HAS	0.001	257	355	1	94	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
395426	Glycos_transf_2	0.001	261	425	3	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD50674.1|GT2	0.0	1	668	1	668
QGI79854.1|GT2	0.0	1	661	1	652
QGI62687.1|GT2	0.0	1	661	1	652
QGI93580.1|GT2	0.0	1	661	1	652
CCT66493.1|GT2	0.0	1	661	1	652

PDB Hits     

FOC4_g10010860-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

FOC4_g10010860-t38_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000080	0.000000

TMHMM  Annotations     

Start	End
161	183
193	215
518	537
547	569
590	612