CAZyme Information: FOC4_g10009839-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10009839-t38_1-p1
• CAZy Family: GH5
• CAZyme Description: Sterol 3-beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
748	KB726307|CGC14	82576.51	8.1444

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726307:975120-977923(-)

Full Sequence      

MSQYTDYYQYEGNLAEATLQQQPTLSHRWSKALAPQPRPADSEPFTTKLNIVIQVVGSRG
DVQPFVALGTELKRHGHRVRLATHNTFESFVHDSGLEFYPIGGDPTELMAYMVRNPGLIP
SVQSLKAGDIGKKRIMVEEMLRGCWLSCVNPDPITFAPFVADAIIANPPSFAHIHCAQAL
GIPLHMMFTMPWTSTAAFPHPLVNVKFGRVDAAEQMKVNYLSYGVVEVLTWQGLGDIINK
WRATLDLEDIAFSQGPRLTEKLGIPFTYCWSPALVPKPRDWSENVDVCGFFFRDPPDYTP
PPALAEFLRDGPTPIYIGFGSIVIDDPNALSHMLLEAIRITGTRALISRGWSKLDGPQSD
NVMFLGDCPHEWLFQRVSAVMHHGGAGTTACGLLYGKPTTIVPFFGDQPFWGNMVASSGA
GPEPIPQKAITVGRLVEAIEFCSTPQAAEAAASIASKMQSENGVKQAVASFHKHLRPYVV
ECDIIKGLPAVWEYSRRRNTIKLSKLAADILMTHLKIDGNKLQQIETRKIIIETRRWDPL
TGVLAAVLGATTDVARAAESRSCVAVTKSAALAFVLGLGALVKAVATAIVEIPFTFTEGL
WQFPRLWGHQVRDFGVIRDWKAGLATWLQVLVFAFYDGLTGLFVQPYLGAKEDGPLGVFK
GIAKAIANLHLMLLAAAVGTGAYPLRGIHQSIIYLISCQTRRSVQLARRLEGRYLAGKAG
TDRVLEHEVLDSFDKLMRREVPRHFMFY

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	74	474	4.7e-46	0.9712041884816754

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	9.30e-73	49	474	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.70e-36	51	446	4	369	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.20e-22	51	199	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	0.001	309	439	222	353	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60584.1|GT1	0.0	1	630	1	700
UPK96969.1|GT1	0.0	35	741	62	811
UQC79556.1|GT1	1.20e-283	40	738	82	837
UPL02209.1|GT1	3.63e-277	45	740	104	846
QMW26390.1|GT1	6.31e-277	37	736	67	806

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	3.09e-75	56	475	27	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	5.20e-75	56	475	47	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	2.18e-29	49	461	1	385	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	4.92e-28	49	461	1	368	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	2.63e-21	49	421	1	347	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	2.44e-123	49	475	193	610	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	1.98e-122	48	477	155	576	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q6C8M8|ATG26_YARLI	3.71e-77	47	475	993	1413	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|Q54IL5|UGT52_DICDI	3.43e-74	49	475	1164	1609	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|P0CN90|ATG26_CRYNJ	5.89e-74	49	506	1034	1491	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000011

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10009839-t38_1-p1.