CAZyme Information: FOC4_g10009820-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10009820-t38_1-p1
• CAZy Family: GH5
• CAZyme Description: Periplasmic beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
771	KB726307|CGC3	83480.72	8.2699

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726307:910930-913449(+)

Full Sequence      

MVHFSVMPLALAGSLAYPVIAAPGPKNEAWKNKALSPAERAEALLPTLKWTEKIAQLGGI
RRLLDPNSSFNRTVYDALYPLQHGILSYGSQLNPAEKVLPFANKVRQEQMQNGKIPYITV
TDSVNSIYVPGGTLFPATLSLSTSWDLDLYGQVTGAIRDENMALGTHWVLSPELDVAKDP
RYGRVGETYGEDVYLVGEFAAQYVRTMEEKDKNGFIKVATTVKHFLYGLGAGGINTASMA
GGTNHLYNDLALPYIRVLKENPASIMVSYSSVDRVPMSINKQLLQGMLRSEMGFEGLLMS
DAMAIPHLHTQSLVASSLKDAATKALRAGLQLELAPQQPAAFPTLVNSSDDQEIVRLVDE
AVKQHLIIKFATGMFDLPLPTMSDLKKVLRSSKHLDVNRKASRESIVLLQNKNKFLPKSK
ISKVALLGPMADIMNPGSYAPSTSARPLYGRTLKGSLEAALGAKNVKYVKGVDIAFVRDS
DSEGIQAAVAAAKEAGLAIVAVGSLSVYSLDPNAGERTDGEFFTHASLGFPGSQQQLLDA
VLDAGVPTIVVLSGGQSFVLNNSTMRADAILHMFLAGEFTADSAVEIIQGKVNPSGKLTV
TMPQADGALPVYYDFLPSDAQGGVSFIQTPNVCATYDYNFPCLKRGYAPMPFGYGLSYTS
FDVSAPKITRKGDTVSISVMVVNTGSVTGKEVVQVYQRLANSEIELPNKRLIRFQKVEVK
PGQSKVVDFSIPKNDLGYYNNAKYQVESGEYIFWTGSSSKLTDLKNATITL

Enzyme Prediction     

No EC number prediction in FOC4_g10009820-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	111	334	1.7e-48	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	5.13e-98	8	771	6	764	beta-glucosidase BglX.
224389	BglX	9.20e-52	130	454	78	386	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	5.66e-51	4	731	14	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.56e-42	52	362	4	310	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	2.98e-32	406	658	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60600.1|GH3	0.0	1	771	1	771
QGI87496.1|GH3	0.0	1	771	1	771
QGI70133.1|GH3	0.0	1	771	1	771
QGJ01022.1|GH3	0.0	1	771	1	771
CCT75117.1|GH3	0.0	1	771	1	771

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	8.69e-88	30	760	7	746	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	6.28e-87	30	760	7	746	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	6.38e-81	10	771	16	784	Chain A, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	4.57e-74	133	771	98	751	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	2.30e-73	133	771	98	751	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KMH9|PLH34_FORAG	3.71e-87	26	759	25	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
sp|T2KMH0|PLH24_FORAG	1.23e-74	128	771	83	722	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	5.10e-74	114	759	103	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	3.55e-73	133	759	118	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|A7LXU3|BGH3B_BACO1	3.47e-63	84	751	86	757	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004748	0.995216	CS pos: 21-22. Pr: 0.9595

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10009820-t38_1-p1.