CAZyme Information: FOC4_g10009724-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10009724-t38_1-p1
• CAZy Family: GH49
• CAZyme Description: Pectate lyase E

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		37175.35	3.7358

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726307:667043-668195(+)

Full Sequence      

MAATLAIGAYAAPAPLITGAPSLSRRQDSEGGSGGSGGSSVLDAPMTIAAGESFDGGNAI
FDRGVSCTGQVEGGDSDAVFILEKGATLSNVRIGPNQIEGVHCNGGCTLNNVVWDAVCED
AFSIKKQEDGETTTINGGGATGAEDKVIQHNGGGTVIIKDFEVSDFGKLYRSCGNCKEMP
ARHVEISGGSASNGKILVGINPNMGDTAKISGIQLTNVPKECITFEGVTDGSEPKEVGTC
DSNAGSGSGSGSGDSTEAPATPTTPADGSETPAATEVADPVETSADGSQGDDQSGDDQSG
DNDDGDKDESDDDKKDSDSDDENKDEQSDNENQDQDSESENQESADNQLAQPSQPSFNFG
SGGFGGF

Enzyme Prediction     

No EC number prediction in FOC4_g10009724-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	38	227	5.3e-72	0.9845360824742269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	3.58e-102	41	232	12	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60682.1|PL3_2	1.25e-202	1	367	7	373
CCT74639.1|PL3_2	2.20e-200	1	367	1	361
QGJ00946.1|PL3_2	2.74e-200	1	367	7	367
QGI70056.1|PL3_2	2.74e-200	1	367	7	367
QGI87418.1|PL3_2	1.54e-192	1	292	7	298

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3B90_A	5.96e-25	62	236	11	205	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
1EE6_A	2.15e-24	41	232	4	188	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
3B4N_A	5.23e-24	45	236	111	323	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B4N_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_A Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
4EW9_A	6.22e-19	41	175	9	139	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	6.36e-19	41	175	10	140	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CJ49|PLYD_ASPTN	5.11e-69	41	244	42	243	Probable pectate lyase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyD PE=3 SV=1
sp|Q5ATC7|PLYH_EMENI	2.54e-68	51	237	57	243	Pectate lyase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyH PE=1 SV=1
sp|A1DCY5|PLYD_NEOFI	3.94e-68	41	244	29	231	Probable pectate lyase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyD PE=3 SV=1
sp|B0YB89|PLYD_ASPFC	4.06e-68	41	244	30	232	Probable pectate lyase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyD PE=3 SV=1
sp|Q4WGV9|PLYD_ASPFU	4.06e-68	41	244	30	232	Probable pectate lyase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.434707	0.565306	CS pos: 21-22. Pr: 0.2865

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10009724-t38_1-p1.