CAZyme Information: FOC4_g10009478-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10009478-t38_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	KB726307|CGC23	40673.62	7.4640

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726307:17443-18666(-)

Full Sequence      

MTYYGHNVNFQQQNPGYNQDGSGQGGYGGDDQRRNDQGGYQQGGPQQYGQQQGGHQQGGP
QQGGYQQQGGYQQDRPGPQGQFDGGDGPDGERGVMGALAGGAAGAFGGHKMGGVTGHSKT
STIVGALAGAFGGHKLQDAAGDWKDERDEKKEEEKRRKEEEKRREEEEERRRKERRDDDR
YESHHHRRRSRSRSSSRGSNRRRGGHYAGNFTASSRDIRLDAHGDYVLHASCKREDGDYQ
HTSISLDKVLENDRGSFRWSAGGHHGSSSSVTVQQGDTLRGIAARFNCSFEEIARHNNIN
NPDLIYPGQTLQVPGGGRHGGGGFGSSARHVRLVDGGQRLEGELSRDGDWVLSSIILDER
IRNFNGTLELV

Enzyme Prediction     

No EC number prediction in FOC4_g10009478-t38_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400991	CVNH	1.12e-19	211	369	1	101	CVNH domain. CyanoVirin-N Homology domains are found in the sugar-binding antiviral protein cyanovirin-N (CVN) as well as filamentous ascomycetes and in the fern Ceratopteris richardii.
212030	LysM	1.52e-14	270	313	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
396179	LysM	2.20e-13	271	314	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
197609	LysM	1.29e-12	272	313	3	44	Lysin motif.
131945	spore_safA	2.61e-09	273	314	1	43	spore coat assembly protein SafA. SafA (YrbB) (SafA) of Bacillus subtilis is a protein found at the interface of the spore cortex and spore coat, and is dependent on SpoVID for its localization. This model is based on the N-terminal LysM (lysin motif) domain (see pfamAM model pfam01476) of SafA and, from several other spore-forming species, the protein with the most similar N-terminal region. However, this set of proteins differs greatly in C-terminal of the LysM domaim; blocks of 12-residue and 13-residue repeats are found in the Bacillus cereus group, tandem LysM domains in Thermoanaerobacter tengcongensis MB4, etc. in which one of which is found in most examples of endospore-forming bacteria. [Cellular processes, Sporulation and germination]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60899.1|CBM50	5.52e-145	1	371	1	401
QGI87230.1|CBM50	1.38e-140	1	371	1	401
QGI69855.1|CBM50	1.38e-140	1	371	1	401
CCT74429.1|CBM50	1.38e-140	1	371	1	401
QGJ00743.1|CBM50	1.38e-140	1	371	1	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2L9Y_A	1.54e-51	205	368	1	164	Solution structure of the MoCVNH-LysM module from the rice blast fungus Magnaporthe oryzae protein (MGG_03307) [Pyricularia oryzae 70-15]
5C8O_A	6.96e-49	205	368	4	151	Crystal structure of MoCVNH3 variant (Mo0v) [Pyricularia oryzae],5C8P_A Crystal structure of MoCVNH3 variant (Mo0v) in complex with (N-GlcNAc)3 [Pyricularia oryzae],5C8Q_B Crystal structure of MoCVNH3 variant (Mo0v) in complex with (N-GlcNAc)4 [Pyricularia oryzae]
2L2F_A	1.19e-09	209	287	2	80	Chain A, Cyanovirin-N HOMOLOG [Fusarium graminearum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2G0D4|SSAAL_STAA8	2.47e-06	266	338	86	165	Probable autolysin SsaALP OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_00671 PE=1 SV=1
sp|Q5HRU2|SLE1_STAEQ	2.51e-06	248	316	126	193	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
sp|Q8CMN2|SLE1_STAES	2.51e-06	248	316	126	193	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
sp|Q9RVY3|Y888_DEIRA	9.82e-06	272	315	207	253	Uncharacterized protein DR_0888 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) OX=243230 GN=DR_0888 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10009478-t38_1-p1.