CAZyme Information: FOC4_g10008562-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10008562-t38_1-p1
• CAZy Family: GH37
• CAZyme Description: Glucan endo-1,6-beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458	KB726324|CGC5	52744.13	6.1961

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726324:927736-929604(+)

Full Sequence      

MATWVVKGLRRNVPTKERNAPEFLLNPDPTNQLTGTATEHQMIVFEIRTSAFITAAAVLT
TSVNAWLPNTEPHALNERDNETFVYPLRTEPNNKRWLPATKKIRGVNLGSLFIYEPWIDS
QEWANTGCEGEKSDFDCVMNKGQDITDKNFQAHWKRWINQTDLDEMLSYGLNTIRVPLGY
WLKEDLVDDSEHFPKRSRLLHHSLNKFIAYANCKNSLHGVPGAQESNQPFTGQYAPTVGF
YSDYNYGRAIEWLEWMTDIIHTKKEYRNVGMLGLVNEPLNWDKAVDSLRKTYYPKACSAI
RKVEDKLKVTSNNRLHIHMMGSLWGSGKPTEFLRDTSFTAFDDHRYLKWDTSVEASHGAY
IKKSCSDDRNTDGPTIVGEWSLAVPDDVEKTDAWNPQTQKEFYTKWFSAQVHAYEENTLG
WVFWTWEASLGDDYRWSYRDAARAGVIPKDLDSLPSVC

Enzyme Prediction     

No EC number prediction in FOC4_g10008562-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	142	439	2.3e-131	0.9966666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	5.98e-13	102	440	17	374	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK93324.1|GH5_15	1.57e-241	49	458	3	414
CCT71223.1|GH5_15	1.19e-205	47	439	1	324
QGI66947.1|GH5_15	1.19e-205	47	439	1	324
QGI97833.1|GH5_15	1.19e-205	47	439	1	324
QGI84184.1|GH5_15	1.19e-205	47	439	1	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	8.56e-19	92	458	3	396	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1EQP_A	1.11e-18	96	458	2	391	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PB1_A	1.16e-18	92	458	4	397	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PF0_A	1.16e-18	92	458	4	397	Chain A, Hypothetical protein XOG1 [Candida albicans]
3N9K_A	2.08e-18	92	458	3	396	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B6Q3|EXGB_EMENI	3.08e-154	65	454	16	403	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1
sp|Q0C8Z0|EXGB_ASPTN	3.91e-146	59	453	14	396	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1
sp|A1DGM6|EXGB_NEOFI	1.47e-142	53	454	5	393	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|Q2TZQ9|EXGB_ASPOR	7.12e-137	53	454	3	395	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgB PE=3 SV=1
sp|B0XRX9|EXGB_ASPFC	9.43e-135	53	439	5	378	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999434	0.000570

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10008562-t38_1-p1.